• Gene id: 23170

Gene Summary

• Gene Symbol: TTLL12   Gene   UCSC   Ensembl
• Aliases: dJ526I14.2
• Gene name: tubulin tyrosine ligase like 12
• Alternate names: tubulin--tyrosine ligase-like protein 12, inactive tubulin--tyrosine ligase-like protein 12, tubulin tyrosine ligase-like family, member 12,
• Gene location: 22q13.2 (43187133: 43166621)     Exons: 14     NC_000022.11
• OMIM: 602320

Protein Summary

• Protein general information: Q14166  
  • Name: Tubulin tyrosine ligase like protein 12 (Inactive tubulin tyrosine ligase like protein 12)
  • Length: 644  
  • Mass: 74404
  • Tissue specificity: Expressed in the basal layer of prostate and endothelial cells. Increased expression in prostatic intraepithelial neoplasia and metastatic lesions. {ECO
• Sequence:

  MEAERGPERRPAERSSPGQTPEEGAQALAEFAALHGPALRASGVPERYWGRLLHKLEHEVFDAGEVFGIMQVEEV
  EEEEDEAAREVRKQQPNPGNELCYKVIVTRESGLQAAHPNSIFLIDHAWTCRVEHARQQLQQVPGLLHRMANLMG
  IEFHGELPSTEAVALVLEEMWKFNQTYQLAHGTAEEKMPVWYIMDEFGSRIQHADVPSFATAPFFYMPQQVAYTL
  LWPLRDLDTGEEVTRDFAYGETDPLIRKCMLLPWAPTDMLDLSSCTPEPPAEHYQAILEENKEKLPLDINPVVHP
  HGHIFKVYTDVQQVASSLTHPRFTLTQSEADADILFNFSHFKDYRKLSQERPGVLLNQFPCENLLTVKDCLASIA
  RRAGGPEGPPWLPRTFNLRTELPQFVSYFQQRERWGEDNHWICKPWNLARSLDTHVTKSLHSIIRHRESTPKVVS
  KYIESPVLFLREDVGKVKFDIRYIVLLRSVRPLRLFVYDVFWLRFSNRAFALNDLDDYEKHFTVMNYDPDVVLKQ
  VHCEEFIPEFEKQYPEFPWTDVQAEIFRAFTELFQVACAKPPPLGLCDYPSSRAMYAVDLMLKWDNGPDGRRVMQ
  PQILEVNFNPDCERACRYHPTFFNDVFSTLFLDQPGGCHVTCLV

• Structural information:
  • Protein Domains: (300..64-)
    (/note="TTL-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00568"-)
  • Interpro: IPR013815  IPR004344  IPR027749  
  • Prosite: PS51221
  • STRING: ENSP00000216129
• Other Databases: GeneCards:  TTLL12  Malacards:  TTLL12

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006464	cellular protein modification process	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0030496	midbody	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0034968	histone lysine methylation	IEA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:1990889	H4K20me3 modified histone binding	IDA	molecular function
GO:0070510	regulation of histone H4-K20 methylation	IDA	NOT|biological process
GO:0015631	tubulin binding	IDA	molecular function
GO:0004835	tubulin-tyrosine ligase activity	IDA	NOT|molecular function
GO:0018024	histone-lysine N-methyltransferase activity	IDA	NOT|molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060339	negative regulation of type I interferon-mediated signaling pathway	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0007346	regulation of mitotic cell cycle	IMP	biological process
GO:0006464	cellular protein modification process	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0030496	midbody	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0034968	histone lysine methylation	IEA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:1990889	H4K20me3 modified histone binding	IDA	molecular function
GO:0070510	regulation of histone H4-K20 methylation	IDA	NOT|biological process
GO:0015631	tubulin binding	IDA	molecular function
GO:0004835	tubulin-tyrosine ligase activity	IDA	NOT|molecular function
GO:0018024	histone-lysine N-methyltransferase activity	IDA	NOT|molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060339	negative regulation of type I interferon-mediated signaling pathway	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0007346	regulation of mitotic cell cycle	IMP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq