• Gene id: 23163

Gene Summary

• Gene Symbol: GGA3   Gene   UCSC   Ensembl
• Gene name: golgi associated, gamma adaptin ear containing, ARF binding protein 3
• Alternate names: ADP-ribosylation factor-binding protein GGA3, Golgi-localized, gamma ear-containing, ARF-binding protein 3,
• Gene location: 17q25.1 (75262362: 75225463)     Exons: 20     NC_000017.11
• Gene summary(Entrez): This gene encodes a member of the Golgi-localized, gamma adaptin ear-containing, ARF-binding (GGA) family. This family includes ubiquitous coat proteins that regulate the trafficking of proteins between the trans-Golgi network and the lysosome. These prot
• OMIM: 606006

Protein Summary

• Protein general information: Q9NZ52  
  • Name: ADP ribosylation factor binding protein GGA3 (Golgi localized, gamma ear containing, ARF binding protein 3)
  • Length: 723  
  • Mass: 78315
  • Tissue specificity: Ubiquitously expressed.
• Sequence:

  MAEAEGESLESWLNKATNPSNRQEDWEYIIGFCDQINKELEGPQIAVRLLAHKIQSPQEWEALQALTVLEACMKN
  CGRRFHNEVGKFRFLNELIKVVSPKYLGDRVSEKVKTKVIELLYSWTMALPEEAKIKDAYHMLKRQGIVQSDPPI
  PVDRTLIPSPPPRPKNPVFDDEEKSKLLAKLLKSKNPDDLQEANKLIKSMVKEDEARIQKVTKRLHTLEEVNNNV
  RLLSEMLLHYSQEDSSDGDRELMKELFDQCENKRRTLFKLASETEDNDNSLGDILQASDNLSRVINSYKTIIEGQ
  VINGEVATLTLPDSEGNSQCSNQGTLIDLAELDTTNSLSSVLAPAPTPPSSGIPILPPPPQASGPPRSRSSSQAE
  ATLGPSSTSNALSWLDEELLCLGLADPAPNVPPKESAGNSQWHLLQREQSDLDFFSPRPGTAACGASDAPLLQPS
  APSSSSSQAPLPPPFPAPVVPASVPAPSAGSSLFSTGVAPALAPKVEPAVPGHHGLALGNSALHHLDALDQLLEE
  AKVTSGLVKPTTSPLIPTTTPARPLLPFSTGPGSPLFQPLSFQSQGSPPKGPELSLASIHVPLESIKPSSALPVT
  AYDKNGFRILFHFAKECPPGRPDVLVVVVSMLNTAPLPVKSIVLQAAVPKSMKVKLQPPSGTELSPFSPIQPPAA
  ITQVMLLANPLKEKVRLRYKLTFALGEQLSTEVGEVDQFPPVEQWGNL

• Structural information:
  • Protein Domains: (16..14-)
    (/note="VHS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00218-)
    (171..29-)
    (/note="GAT-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00373-)
    (594..71-)
    (/note="GAE-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00093"-)
  • Interpro: IPR008152  IPR013041  IPR008942  IPR008153  IPR004152   IPR038425  IPR027422  IPR041198  IPR002014  
  • Prosite: PS50180 PS50909 PS50179
  • PDB: 1JPL 1JUQ 1LF8 1P4U 1WR6 1YD8
  • PDBsum: 1JPL 1JUQ 1LF8 1P4U 1WR6 1YD8
  • DIP: 31600
  • STRING: ENSP00000438085
• Other Databases: GeneCards:  GGA3  Malacards:  GGA3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031648	protein destabilization	IDA	biological process
GO:0031647	regulation of protein stability	IDA	biological process
GO:0043130	ubiquitin binding	IDA	molecular function
GO:1902430	negative regulation of amyloid-beta formation	IDA	biological process
GO:0031647	regulation of protein stability	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0043001	Golgi to plasma membrane protein transport	IMP	biological process
GO:0034394	protein localization to cell surface	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005802	trans-Golgi network	IEA	cellular component
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0030306	ADP-ribosylation factor binding	IEA	molecular function
GO:0006886	intracellular protein transport	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0030306	ADP-ribosylation factor binding	IDA	molecular function
GO:0005802	trans-Golgi network	IDA	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0031901	early endosome membrane	TAS	cellular component
GO:0031901	early endosome membrane	TAS	cellular component
GO:0055038	recycling endosome membrane	TAS	cellular component
GO:0055038	recycling endosome membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0055037	recycling endosome	IEA	cellular component
GO:0032456	endocytic recycling	IEA	biological process
GO:0045732	positive regulation of protein catabolic process	IEA	biological process
GO:0005769	early endosome	IEA	cellular component
GO:0061462	protein localization to lysosome	IEA	biological process
GO:0031901	early endosome membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0055038	recycling endosome membrane	IEA	cellular component
GO:0010008	endosome membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005802	trans-Golgi network	IDA	cellular component
GO:0030306	ADP-ribosylation factor binding	IDA	molecular function
GO:0006886	intracellular protein transport	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04142	Lysosome

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Male factor infertility	MIK: 29961538
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray