• Gene id: 23154

Gene Summary

• Gene Symbol: NCDN   Gene   UCSC   Ensembl
• Gene name: neurochondrin
• Alternate names: neurochondrin, norbin,
• Gene location: 1p34.3 (35557791: 35566778)     Exons: 15     NC_000001.11
• Gene summary(Entrez): This gene encodes a leucine-rich cytoplasmic protein, which is highly similar to a mouse protein that negatively regulates Ca/calmodulin-dependent protein kinase II phosphorylation and may be essential for spatial learning processes. Several alternatively
• OMIM: 608458

Protein Summary

• Protein general information: Q9UBB6  
  • Name: Neurochondrin
  • Length: 729  
  • Mass: 78864
  • Tissue specificity: Abundantly expressed in whole adult brain and in all individual brain regions examined, including spinal cord. Weakly expressed in ovary, testis, fetal brain and small intestine. {ECO
• Sequence:

  MSCCDLAAAGQLGKASIMASDCEPALNQAEGRNPTLERYLGALREAKNDSEQFAALLLVTKAVKAGDIDAKTRRR
  IFDAVGFTFPNRLLTTKEAPDGCPDHVLRALGVALLACFCSDPELAAHPQVLNKIPILSTFLTARGDPDDAARRS
  MIDDTYQCLTAVAGTPRGPRHLIAGGTVSALCQAYLGHGYGFDQALALLVGLLAAAETQCWKEAEPDLLAVLRGL
  SEDFQKAEDASKFELCQLLPLFLPPTTVPPECYRDLQAGLARILGSKLSSWQRNPALKLAARLAHACGSDWIPAG
  SSGSKFLALLVNLACVEVRLALEETGTEVKEDVVTACYALMELGIQECTRCEQSLLKEPQKVQLVSVMKEAIGAV
  IHYLLQVGSEKQKEPFVFASVRILGAWLAEETSSLRKEVCQLLPFLVRYAKTLYEEAEEANDLSQQVANLAISPT
  TPGPTWPGDALRLLLPGWCHLTVEDGPREILIKEGAPSLLCKYFLQQWELTSPGHDTSVLPDSVEIGLQTCCHIF
  LNLVVTAPGLIKRDACFTSLMNTLMTSLPALVQQQGRLLLAANVATLGLLMARLLSTSPALQGTPASRGFFAAAI
  LFLSQSHVARATPGSDQAVLALSPEYEGIWADLQELWFLGMQAFTGCVPLLPWLAPAALRSRWPQELLQLLGSVS
  PNSVKPEMVAAYQGVLVELARANRLCREAMRLQAGEETASHYRMAALEQCLSEP

• Structural information:
  • Interpro: IPR016024  IPR008709  
  • STRING: ENSP00000362340
• Other Databases: GeneCards:  NCDN  Malacards:  NCDN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0031175	neuron projection development	ISS	biological process
GO:0030425	dendrite	ISS	cellular component
GO:0030424	axon	ISS	NOT|cellular component
GO:0005829	cytosol	ISS	cellular component
GO:0043025	neuronal cell body	ISS	cellular component
GO:0005634	nucleus	ISS	NOT|cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0010008	endosome membrane	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0043204	perikaryon	IEA	cellular component
GO:0045453	bone resorption	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0031175	neuron projection development	IEA	biological process
GO:0048168	regulation of neuronal synaptic plasticity	IEA	biological process
GO:0098794	postsynapse	IEA	cellular component
GO:0031175	neuron projection development	IEA	biological process
GO:0043005	neuron projection	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0098794	postsynapse	IEA	cellular component
GO:0010008	endosome membrane	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016020	membrane	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Male infertility	MIK: 26361204
Embryo quality	MIK: 26361204
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
26361204	Male infertility, Embryo quality			181 (127 men undergoing IVF treatment, 54 normozoospermic, fertile men)	Male infertility	Microarray