• Gene id: 23151

Gene Summary

• Gene Symbol: GRAMD4   Gene   UCSC   Ensembl
• Aliases: DIP
• Gene name: GRAM domain containing 4
• Alternate names: GRAM domain-containing protein 4, death-inducing-protein,
• Gene location: 22q13.31 (46576016: 46682755)     Exons: 25     NC_000022.11
• Gene summary(Entrez): GRAMD4 is a mitochondrial effector of E2F1 (MIM 189971)-induced apoptosis (Stanelle et al., 2005 [PubMed 15565177]).[supplied by OMIM, Jan 2011]
• OMIM: 612082

Protein Summary

• Protein general information: Q6IC98  
  • Name: GRAM domain containing protein 4 (Death inducing protein)
  • Length: 578  
  • Mass: 66408
  • Tissue specificity: Expressed in lung and in primary lung squamous cell carcinoma (LSCC). {ECO
• Sequence:

  MLRRLDKIRFRGHKRDDFLDLAESPNASDTECSDEIPLKVPRTSPRDSEELRDPAGPGTLIMATGVQDFNRTEFD
  RLNEIKGHLEIALLEKHFLQEELRKLREETNAEMLRQELDRERQRRMELEQKVQEVLKARTEEQMAQQPPKGQAQ
  ASNGAERRSQGLSSRLQKWFYERFGEYVEDFRFQPEENTVETEEPLSARRLTENMRRLKRGAKPVTNFVKNLSAL
  SDWYSVYTSAIAFTVYMNAVWHGWAIPLFLFLAILRLSLNYLIARGWRIQWSIVPEVSEPVEPPKEDLTVSEKFQ
  LVLDVAQKAQNLFGKMADILEKIKNLFMWVQPEITQKLYVALWAAFLASCFFPYRLVGLAVGLYAGIKFFLIDFI
  FKRCPRLRAKYDTPYIIWRSLPTDPQLKERSSAAVSRRLQTTSSRSYVPSAPAGLGKEEDAGRFHSTKKGNFHEI
  FNLTENERPLAVCENGWRCCLINRDRKMPTDYIRNGVLYVTENYLCFESSKSGSSKRNKVIKLVDITDIQKYKVL
  SVLPGSGMGIAVSTPSTQKPLVFGAMVHRDEAFETILSQYIKITSAAASGGDS

• Structural information:
  • Protein Domains: (445..52-)
    (/note="GRAM"-)
  • Interpro: IPR004182  IPR037847  IPR037845  IPR011993  
  • CDD: cd13221
  • STRING: ENSP00000385689
• Other Databases: GeneCards:  GRAMD4  Malacards:  GRAMD4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043280	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process	IBA	biological process
GO:0034164	negative regulation of toll-like receptor 9 signaling pathway	IBA	biological process
GO:0005739	mitochondrion	IBA	cellular component
GO:0034164	negative regulation of toll-like receptor 9 signaling pathway	ISS	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0034164	negative regulation of toll-like receptor 9 signaling pathway	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0031966	mitochondrial membrane	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0003674	molecular_function	ND	molecular function
GO:0043280	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process	IMP	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq