• Gene id: 23144

Gene Summary

• Gene Symbol: ZC3H3   Gene   UCSC   Ensembl
• Aliases: SMICL, ZC3HDC3
• Gene name: zinc finger CCCH-type containing 3
• Alternate names: zinc finger CCCH domain-containing protein 3, smad-interacting CPSF-like factor, zinc finger CCCH-type domain containing 3,
• Gene location: 8q24.3 (143549728: 143437654)     Exons: 16     NC_000008.11
• OMIM: 605108

Protein Summary

• Protein general information: Q8IXZ2  
  • Name: Zinc finger CCCH domain containing protein 3 (Smad interacting CPSF like factor)
  • Length: 948  
  • Mass: 101941
• Sequence:

  MEEKEILRRQIRLLQGLIDDYKTLHGNAPAPGTPAASGWQPPTYHSGRAFSARYPRPSRRGYSSHHGPSWRKKYS
  LVNRPPGPSDPPADHAVRPLHGARGGQPPVPQQHVLERQVQLSQGQNVVIKVKPPSKSGSASASGAQRGSLEEFE
  ETPWSDQRPREGEGEPPRGQLQPSRPTRARGTCSVEDPLLVCQKEPGKPRMVKSVGSVGDSPREPRRTVSESVIA
  VKASFPSSALPPRTGVALGRKLGSHSVASCAPQLLGDRRVDAGHTDQPVPSGSVGGPARPASGPRQAREASLVVT
  CRTNKFRKNNYKWVAASSKSPRVARRALSPRVAAENVCKASAGMANKVEKPQLIADPEPKPRKPATSSKPGSAPS
  KYKWKASSPSASSSSSFRWQSEASSKDHASQLSPVLSRSPSGDRPAVGHSGLKPLSGETPLSAYKVKSRTKIIRR
  RSSTSLPGDKKSGTSPAATAKSHLSLRRRQALRGKSSPVLKKTPNKGLVQVTTHRLCRLPPSRAHLPTKEASSLH
  AVRTAPTSKVIKTRYRIVKKTPASPLSAPPFPLSLPSWRARRLSLSRSLVLNRLRPVASGGGKAQPGSPWWRSKG
  YRCIGGVLYKVSANKLSKTSGQPSDAGSRPLLRTGRLDPAGSCSRSLASRAVQRSLAIIRQARQRREKRKEYCMY
  YNRFGRCNRGERCPYIHDPEKVAVCTRFVRGTCKKTDGTCPFSHHVSKEKMPVCSYFLKGICSNSNCPYSHVYVS
  RKAEVCSDFLKGYCPLGAKCKKKHTLLCPDFARRGACPRGAQCQLLHRTQKRHSRRAATSPAPGPSDATARSRVS
  ASHGPRKPSASQRPTRQTPSSAALTAAAVAAPPHCPGGSASPSSSKASSSSSSSSSPPASLDHEAPSLQEAALAA
  ACSNRLCKLPSFISLQSSPSPGAQPRVRAPRAPLTKDSGKPLHIKPRL

• Structural information:
  • Interpro: IPR000571  IPR036855  
  • Prosite: PS50103
  • STRING: ENSP00000262577
• Other Databases: GeneCards:  ZC3H3  Malacards:  ZC3H3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:1900363	regulation of mRNA polyadenylation	IMP	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0051028	mRNA transport	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0032927	positive regulation of activin receptor signaling pathway	IEA	biological process
GO:0031124	mRNA 3'-end processing	IEA	biological process
GO:0070412	R-SMAD binding	IEA	molecular function
GO:0046332	SMAD binding	IEA	molecular function
GO:0005847	mRNA cleavage and polyadenylation specificity factor complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0003674	molecular_function	ND	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:1900363	regulation of mRNA polyadenylation	IMP	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0051028	mRNA transport	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0032927	positive regulation of activin receptor signaling pathway	IEA	biological process
GO:0031124	mRNA 3'-end processing	IEA	biological process
GO:0070412	R-SMAD binding	IEA	molecular function
GO:0046332	SMAD binding	IEA	molecular function
GO:0005847	mRNA cleavage and polyadenylation specificity factor complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray