• Gene id: 23122

Gene Summary

• Gene Symbol: CLASP2   Gene   UCSC   Ensembl
• Gene name: cytoplasmic linker associated protein 2
• Alternate names: CLIP-associating protein 2, CLIP-associating protein CLASP2, multiple asters (Mast)-like homolog 2, protein Orbit homolog 2,
• Gene location: 3p22.3 (33718355: 33496244)     Exons: 45     NC_000003.12
• OMIM: 614786

Protein Summary

• Protein general information: O75122  
  • Name: CLIP associating protein 2 (Cytoplasmic linker associated protein 2) (Protein Orbit homolog 2) (hOrbit2)
  • Length: 1294  
  • Mass: 141064
  • Tissue specificity: Brain-specific.
• Sequence:

  MAMGDDKSFDDEESVDGNRPSSAASAFKVPAPKTSGNPANSARKPGSAGGPKVGGASKEGGAGAVDEDDFIKAFT
  DVPSIQIYSSRELEETLNKIREILSDDKHDWDQRANALKKIRSLLVAGAAQYDCFFQHLRLLDGALKLSAKDLRS
  QVVREACITVAHLSTVLGNKFDHGAEAIVPTLFNLVPNSAKVMATSGCAAIRFIIRHTHVPRLIPLITSNCTSKS
  VPVRRRSFEFLDLLLQEWQTHSLERHAAVLVETIKKGIHDADAEARVEARKTYMGLRNHFPGEAETLYNSLEPSY
  QKSLQTYLKSSGSVASLPQSDRSSSSSQESLNRPFSSKWSTANPSTVAGRVSAGSSKASSLPGSLQRSRSDIDVN
  AAAGAKAHHAAGQSVRSGRLGAGALNAGSYASLEDTSDKLDGTASEDGRVRAKLSAPLAGMGNAKADSRGRSRTK
  MVSQSQPGSRSGSPGRVLTTTALSTVSSGVQRVLVNSASAQKRSKIPRSQGCSREASPSRLSVARSSRIPRPSVS
  QGCSREASRESSRDTSPVRSFQPLASRHHSRSTGALYAPEVYGASGPGYGISQSSRLSSSVSAMRVLNTGSDVEE
  AVADALKKPARRRYESYGMHSDDDANSDASSACSERSYSSRNGSIPTYMRQTEDVAEVLNRCASSNWSERKEGLL
  GLQNLLKNQRTLSRVELKRLCEIFTRMFADPHGKRVFSMFLETLVDFIQVHKDDLQDWLFVLLTQLLKKMGADLL
  GSVQAKVQKALDVTRESFPNDLQFNILMRFTVDQTQTPSLKVKVAILKYIETLAKQMDPGDFINSSETRLAVSRV
  ITWTTEPKSSDVRKAAQSVLISLFELNTPEFTMLLGALPKTFQDGATKLLHNHLRNTGNGTQSSMGSPLTRPTPR
  SPANWSSPLTSPTNTSQNTLSPSAFDYDTENMNSEDIYSSLRGVTEAIQNFSFRSQEDMNEPLKRDSKKDDGDSM
  CGGPGMSDPRAGGDATDSSQTALDNKASLLHSMPTHSSPRSRDYNPYNYSDSISPFNKSALKEAMFDDDADQFPD
  DLSLDHSDLVAELLKELSNHNERVEERKIALYELMKLTQEESFSVWDEHFKTILLLLLETLGDKEPTIRALALKV
  LREILRHQPARFKNYAELTVMKTLEAHKDPHKEVVRSAEEAASVLATSISPEQCIKVLCPIIQTADYPINLAAIK
  MQTKVIERVSKETLNLLLPEIMPGLIQGYDNSESSVRKACVFCLVAVHAVIGDELKPHLSQLTGSKMKLLNLYIK
  RAQTGSGGADPTTDVSGQS

• Structural information:
  • Interpro: IPR011989  IPR016024  IPR024395  IPR034085  
  • PDB: 3WOY 5NR4
  • PDBsum: 3WOY 5NR4
  • DIP: 36804
  • STRING: ENSP00000417518
• Other Databases: GeneCards:  CLASP2  Malacards:  CLASP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0090307	mitotic spindle assembly	IBA	biological process
GO:0045180	basal cortex	IBA	cellular component
GO:0040001	establishment of mitotic spindle localization	IBA	biological process
GO:0031110	regulation of microtubule polymerization or depolymerization	IBA	biological process
GO:0008017	microtubule binding	IBA	molecular function
GO:0005881	cytoplasmic microtubule	IBA	cellular component
GO:0005876	spindle microtubule	IBA	cellular component
GO:0005815	microtubule organizing center	IBA	cellular component
GO:0000226	microtubule cytoskeleton organization	IBA	biological process
GO:0008017	microtubule binding	IDA	molecular function
GO:0032587	ruffle membrane	IDA	cellular component
GO:0005802	trans-Golgi network	IDA	cellular component
GO:0051010	microtubule plus-end binding	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005874	microtubule	IDA	cellular component
GO:0005874	microtubule	IDA	cellular component
GO:0000776	kinetochore	IMP	colocalizes with
GO:0007052	mitotic spindle organization	IMP	biological process
GO:0034453	microtubule anchoring	IMP	biological process
GO:0007020	microtubule nucleation	IMP	biological process
GO:0000226	microtubule cytoskeleton organization	IMP	biological process
GO:0072686	mitotic spindle	IMP	colocalizes with
GO:0010458	exit from mitosis	IMP	biological process
GO:0032886	regulation of microtubule-based process	IMP	biological process
GO:0031023	microtubule organizing center organization	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000776	kinetochore	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0051301	cell division	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005874	microtubule	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005938	cell cortex	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0032587	ruffle membrane	IEA	cellular component
GO:0000777	condensed chromosome kinetochore	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0045180	basal cortex	IDA	cellular component
GO:0005874	microtubule	IDA	colocalizes with
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005925	focal adhesion	IDA	colocalizes with
GO:0031252	cell leading edge	IDA	cellular component
GO:0051010	microtubule plus-end binding	IDA	molecular function
GO:0005881	cytoplasmic microtubule	IDA	cellular component
GO:0034453	microtubule anchoring	IMP	biological process
GO:0010717	regulation of epithelial to mesenchymal transition	IMP	biological process
GO:0072659	protein localization to plasma membrane	IMP	biological process
GO:1904261	positive regulation of basement membrane assembly involved in embryonic body morphogenesis	IMP	biological process
GO:0005828	kinetochore microtubule	TAS	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0007163	establishment or maintenance of cell polarity	TAS	biological process
GO:0031110	regulation of microtubule polymerization or depolymerization	IMP	biological process
GO:0000226	microtubule cytoskeleton organization	IMP	biological process
GO:0007030	Golgi organization	IMP	biological process
GO:0010470	regulation of gastrulation	IMP	biological process
GO:0002162	dystroglycan binding	IPI	molecular function
GO:0007026	negative regulation of microtubule depolymerization	NAS	biological process
GO:0005737	cytoplasm	NAS	cellular component
GO:0010634	positive regulation of epithelial cell migration	IMP	biological process
GO:0051497	negative regulation of stress fiber assembly	IMP	biological process
GO:0006903	vesicle targeting	IMP	biological process
GO:0090091	positive regulation of extracellular matrix disassembly	IMP	biological process
GO:0051895	negative regulation of focal adhesion assembly	IMP	biological process
GO:0045921	positive regulation of exocytosis	IMP	biological process
GO:1903690	negative regulation of wound healing, spreading of epidermal cells	IMP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq