• Gene id: 23118

Gene Summary

• Gene Symbol: TAB2   Gene   UCSC   Ensembl
• Aliases: CHTD2, MAP3K7IP2, TAB-2
• Gene name: TGF-beta activated kinase 1 (MAP3K7) binding protein 2
• Alternate names: TGF-beta-activated kinase 1 and MAP3K7-binding protein 2, TAK1-binding protein 2, mitogen-activated protein kinase kinase kinase 7-interacting protein 2,
• Gene location: 6q25.1 (149217923: 149411612)     Exons: 9     NC_000006.12
• Gene summary(Entrez): The protein encoded by this gene is an activator of MAP3K7/TAK1, which is required for for the IL-1 induced activation of nuclear factor kappaB and MAPK8/JNK. This protein forms a kinase complex with TRAF6, MAP3K7 and TAB1, and it thus serves as an adapto
• OMIM: 605101

Protein Summary

• Protein general information: Q9NYJ8  
  • Name: TGF beta activated kinase 1 and MAP3K7 binding protein 2 (Mitogen activated protein kinase kinase kinase 7 interacting protein 2) (TAK1 binding protein 2) (TAB 2) (TGF beta activated kinase 1 binding protein 2)
  • Length: 693  
  • Mass: 76494
  • Tissue specificity: Widely expressed. In the embryo, expressed in the ventricular trabeculae, endothelial cells of the conotruncal cushions of the outflow tract and in the endothelial cells lining the developing aortic valves. {ECO
• Sequence:

  MAQGSHQIDFQVLHDLRQKFPEVPEVVVSRCMLQNNNNLDACCAVLSQESTRYLYGEGDLNFSDDSGISGLRNHM
  TSLNLDLQSQNIYHHGREGSRMNGSRTLTHSISDGQLQGGQSNSELFQQEPQTAPAQVPQGFNVFGMSSSSGASN
  SAPHLGFHLGSKGTSSLSQQTPRFNPIMVTLAPNIQTGRNTPTSLHIHGVPPPVLNSPQGNSIYIRPYITTPGGT
  TRQTQQHSGWVSQFNPMNPQQVYQPSQPGPWTTCPASNPLSHTSSQQPNQQGHQTSHVYMPISSPTTSQPPTIHS
  SGSSQSSAHSQYNIQNISTGPRKNQIEIKLEPPQRNNSSKLRSSGPRTSSTSSSVNSQTLNRNQPTVYIAASPPN
  TDELMSRSQPKVYISANAATGDEQVMRNQPTLFISTNSGASAASRNMSGQVSMGPAFIHHHPPKSRAIGNNSATS
  PRVVVTQPNTKYTFKITVSPNKPPAVSPGVVSPTFELTNLLNHPDHYVETENIQHLTDPTLAHVDRISETRKLSM
  GSDDAAYTQALLVHQKARMERLQRELEIQKKKLDKLKSEVNEMENNLTRRRLKRSNSISQIPSLEEMQQLRSCNR
  QLQIDIDCLTKEIDLFQARGPHFNPSAIHNFYDNIGFVGPVPPKPKDQRSIIKTPKTQDTEDDEGAQWNCTACTF
  LNHPALIRCEQCEMPRHF

• Structural information:
  • Protein Domains: (8..5-)
    (/note="CUE-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00468"-)
  • Interpro: IPR003892  IPR041911  IPR001876  IPR036443  
  • Prosite: PS51140 PS01358 PS50199
  • CDD: cd14362
  • PDB: 2DAE 2WWZ 2WX0 2WX1
  • PDBsum: 2DAE 2WWZ 2WX0 2WX1
  • DIP: 27525
  • STRING: ENSP00000356426
• Other Databases: GeneCards:  TAB2  Malacards:  TAB2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032496	response to lipopolysaccharide	IDA	biological process
GO:0010507	negative regulation of autophagy	TAS	biological process
GO:0045860	positive regulation of protein kinase activity	IBA	biological process
GO:0070530	K63-linked polyubiquitin modification-dependent protein binding	IBA	molecular function
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IBA	biological process
GO:0070530	K63-linked polyubiquitin modification-dependent protein binding	IDA	molecular function
GO:0045860	positive regulation of protein kinase activity	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0007507	heart development	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007249	I-kappaB kinase/NF-kappaB signaling	TAS	biological process
GO:0007249	I-kappaB kinase/NF-kappaB signaling	TAS	biological process
GO:0007249	I-kappaB kinase/NF-kappaB signaling	TAS	biological process
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0050852	T cell receptor signaling pathway	TAS	biological process
GO:0070498	interleukin-1-mediated signaling pathway	TAS	biological process
GO:0000187	activation of MAPK activity	TAS	biological process
GO:0002223	stimulatory C-type lectin receptor signaling pathway	TAS	biological process
GO:0002755	MyD88-dependent toll-like receptor signaling pathway	TAS	biological process
GO:0002755	MyD88-dependent toll-like receptor signaling pathway	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007254	JNK cascade	TAS	biological process
GO:0038095	Fc-epsilon receptor signaling pathway	TAS	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	TAS	biological process
GO:0070423	nucleotide-binding oligomerization domain containing signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IEP	biological process

KEGG pathways

Pathway id	Pathway name
hsa05168	Herpes simplex virus 1 infection
hsa04010	MAPK signaling pathway
hsa05131	Shigellosis
hsa05132	Salmonella infection
hsa05130	Pathogenic Escherichia coli infection
hsa05170	Human immunodeficiency virus 1 infection
hsa05169	Epstein-Barr virus infection
hsa04621	NOD-like receptor signaling pathway
hsa05161	Hepatitis B
hsa04380	Osteoclast differentiation
hsa05135	Yersinia infection
hsa05162	Measles
hsa04668	TNF signaling pathway
hsa04064	NF-kappa B signaling pathway
hsa04620	Toll-like receptor signaling pathway
hsa05145	Toxoplasmosis
hsa04657	IL-17 signaling pathway
hsa05140	Leishmaniasis

Diseases

Associated diseases	References
Congenital heart defects, multiple type	KEGG:H02199
Congenital heart defects, multiple type	KEGG:H02199
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)