• Gene id: 23107

Gene Summary

• Gene Symbol: MRPS27   Gene   UCSC   Ensembl
• Aliases: MRP-S27, S27mt
• Gene name: mitochondrial ribosomal protein S27
• Alternate names: 28S ribosomal protein S27, mitochondrial, mitochondrial 28S ribosomal protein S27, mitochondrial small ribosomal subunit protein mS27,
• Gene location: 5q13.2 (72320239: 72219402)     Exons: 11     NC_000005.10
• Gene summary(Entrez): Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
• OMIM: 611989

Protein Summary

• Protein general information: Q92552  
  • Name: 28S ribosomal protein S27, mitochondrial (MRP S27) (S27mt) (Mitochondrial ribosomal protein S27) (Mitochondrial small ribosomal subunit protein mS27)
  • Length: 414  
  • Mass: 47611
  • Tissue specificity: Overexpressed in hepatocellular carcinoma tissues compared with adjacent non-tumoral liver tissues (at protein level) (PubMed
• Sequence:

  MAASIVRRGMLLARQVVLPQLSPAGKRYLLSSAYVDSHKWEAREKEHYCLADLASLMDKTFERKLPVSSLTISRL
  IDNISSREEIDHAEYYLYKFRHSPNCWYLRNWTIHTWIRQCLKYDAQDKALYTLVNKVQYGIFPDNFTFNLLMDS
  FIKKENYKDALSVVFEVMMQEAFEVPSTQLLSLYVLFHCLAKKTDFSWEEERNFGASLLLPGLKQKNSVGFSSQL
  YGYALLGKVELQQGLRAVYHNMPLIWKPGYLDRALQVMEKVAASPEDIKLCREALDVLGAVLKALTSADGASEEQ
  SQNDEDNQGSEKLVEQLDIEETEQSKLPQYLERFKALHSKLQALGKIESEGLLSLTTQLVKEKLSTCEAEDIATY
  EQNLQQWHLDLVQLIQREQQQREQAKQEYQAQKAAKASA

• Structural information:
  • Interpro: IPR019266  IPR034913  IPR002885  IPR011990  
  • Prosite: PS51375
  • PDB: 3J9M 6NU2 6NU3
  • PDBsum: 3J9M 6NU2 6NU3
  • DIP: 44136
  • STRING: ENSP00000426941
• Other Databases: GeneCards:  MRPS27  Malacards:  MRPS27

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005739	mitochondrion	IBA	cellular component
GO:0005763	mitochondrial small ribosomal subunit	IDA	cellular component
GO:0097177	mitochondrial ribosome binding	IDA	molecular function
GO:0019843	rRNA binding	IDA	molecular function
GO:0000049	tRNA binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0008283	cell population proliferation	IMP	biological process
GO:0070131	positive regulation of mitochondrial translation	IMP	biological process
GO:0000049	tRNA binding	IEA	molecular function
GO:0019843	rRNA binding	IEA	molecular function
GO:0005840	ribosome	IEA	cellular component
GO:0006417	regulation of translation	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0070125	mitochondrial translational elongation	TAS	biological process
GO:0070126	mitochondrial translational termination	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)