• Gene id: 231

Gene Summary

• Gene Symbol: AKR1B1   Gene   UCSC   Ensembl
• Aliases: ADR, ALDR1, ALR2, AR
• Gene name: aldo-keto reductase family 1 member B
• Alternate names: aldo-keto reductase family 1 member B1, Lii5-2 CTCL tumor antigen, aldehyde reductase 1, aldose reductase, low Km aldose reductase,
• Gene location: 7q33 (134459238: 134442349)     Exons: 11     NC_000007.14
• Gene summary(Entrez): This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member catalyzes the reduction of a number of aldehydes, including the aldehyde form of glucose, and is thereby implicated i
• OMIM: 103880

Protein Summary

• Protein general information: P15121  
  • Name: Aldo keto reductase family 1 member B1 (EC 1.1.1.300) (EC 1.1.1.372) (EC 1.1.1.54) (Aldehyde reductase) (Aldose reductase) (AR) (EC 1.1.1.21)
  • Length: 316  
  • Mass: 35853
  • Tissue specificity: Highly expressed in embryonic epithelial cells (EUE) in response to osmotic stress. {ECO
• Sequence:

  MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFI
  VSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVD
  EGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPED
  PSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCA
  LLSCTSHKDYPFHEEF

• Structural information:
  • Interpro: IPR018170  IPR020471  IPR023210  IPR036812  
  • Prosite: PS00798 PS00062 PS00063
  • CDD: cd06660
  • PDB: 1ABN 1ADS 1AZ1 1AZ2 1EF3 1EL3 1IEI 1MAR 1PWL 1PWM 1T40 1T41 1US0 1X96 1X97 1X98 1XGD 1Z3N 1Z89 1Z8A 2ACQ 2ACR 2ACS 2ACU 2AGT 2DUX 2DUZ 2DV0 2F2K 2FZ8 2FZ9 2FZB 2FZD 2HV5 2HVN 2HVO 2I16 2I17 2IKG 2IKH 2IKI 2IKJ 2INE 2INZ 2IPW 2IQ0 2IQD 2IS7 2ISF 2J8T 2NVC 2NVD 2PD5 2PD9 2PDB 2PDC 2PDF 2PDG 2PDH 2PDI 2PDJ 2PDK 2PDL 2PD
  • PDBsum: 1ABN 1ADS 1AZ1 1AZ2 1EF3 1EL3 1IEI 1MAR 1PWL 1PWM 1T40 1T41 1US0 1X96 1X97 1X98 1XGD 1Z3N 1Z89 1Z8A 2ACQ 2ACR 2ACS 2ACU 2AGT 2DUX 2DUZ 2DV0 2F2K 2FZ8 2FZ9 2FZB 2FZD 2HV5 2HVN 2HVO 2I16 2I17 2IKG 2IKH 2IKI 2IKJ 2INE 2INZ 2IPW 2IQ0 2IQD 2IS7 2ISF 2J8T 2NVC 2NVD 2PD5 2PD9 2PDB 2PDC 2PDF 2PDG 2PDH 2PDI 2PDJ 2PDK 2PDL 2PD
  • STRING: ENSP00000285930
• Other Databases: GeneCards:  AKR1B1  Malacards:  AKR1B1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IBA	cellular component
GO:0008106	alcohol dehydrogenase (NADP+) activity	IBA	molecular function
GO:0004032	alditol:NADP+ 1-oxidoreductase activity	IBA	molecular function
GO:0016491	oxidoreductase activity	IBA	molecular function
GO:0001758	retinal dehydrogenase activity	IDA	molecular function
GO:0001523	retinoid metabolic process	IMP	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0004032	alditol:NADP+ 1-oxidoreductase activity	TAS	molecular function
GO:0005615	extracellular space	TAS	cellular component
GO:0005975	carbohydrate metabolic process	TAS	biological process
GO:0004032	alditol:NADP+ 1-oxidoreductase activity	IEA	molecular function
GO:0047655	allyl-alcohol dehydrogenase activity	IEA	molecular function
GO:0052650	NADP-retinol dehydrogenase activity	IEA	molecular function
GO:0004032	alditol:NADP+ 1-oxidoreductase activity	EXP	molecular function
GO:0004032	alditol:NADP+ 1-oxidoreductase activity	EXP	molecular function
GO:0006700	C21-steroid hormone biosynthetic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0046370	fructose biosynthetic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0072205	metanephric collecting duct development	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0035809	regulation of urine volume	IEA	biological process
GO:0097238	cellular response to methylglyoxal	IEA	biological process
GO:0097066	response to thyroid hormone	IEA	biological process
GO:0060135	maternal process involved in female pregnancy	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0042629	mast cell granule	IEA	cellular component
GO:0042415	norepinephrine metabolic process	IEA	biological process
GO:0031098	stress-activated protein kinase signaling cascade	IEA	biological process
GO:0018931	naphthalene metabolic process	IEA	biological process
GO:0010033	response to organic substance	IEA	biological process
GO:0009414	response to water deprivation	IEA	biological process
GO:0006061	sorbitol biosynthetic process	IEA	biological process
GO:0005996	monosaccharide metabolic process	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0004032	alditol:NADP+ 1-oxidoreductase activity	IEA	molecular function
GO:0003091	renal water homeostasis	IEA	biological process
GO:0002070	epithelial cell maturation	IEA	biological process
GO:1901653	cellular response to peptide	IEA	biological process
GO:0097454	Schwann cell microvillus	IEA	cellular component
GO:0072061	inner medullary collecting duct development	IEA	biological process
GO:0048661	positive regulation of smooth muscle cell proliferation	IEA	biological process
GO:0046427	positive regulation of receptor signaling pathway via JAK-STAT	IEA	biological process
GO:0043220	Schmidt-Lanterman incisure	IEA	cellular component
GO:0033010	paranodal junction	IEA	cellular component
GO:0032838	plasma membrane bounded cell projection cytoplasm	IEA	cellular component
GO:0004032	alditol:NADP+ 1-oxidoreductase activity	IEA	molecular function
GO:0001894	tissue homeostasis	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0042572	retinol metabolic process	IEA	biological process
GO:0022900	electron transport chain	IEA	biological process
GO:0055114	oxidation-reduction process	IDA	biological process
GO:0043795	glyceraldehyde oxidoreductase activity	IDA	molecular function
GO:0004032	alditol:NADP+ 1-oxidoreductase activity	IDA	molecular function
GO:0071475	cellular hyperosmotic salinity response	IDA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0044598	doxorubicin metabolic process	IMP	biological process
GO:0044597	daunorubicin metabolic process	IMP	biological process
GO:0009055	electron transfer activity	TAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00561	Glycerolipid metabolism
hsa00040	Pentose and glucuronate interconversions
hsa00051	Fructose and mannose metabolism
hsa00052	Galactose metabolism
hsa00790	Folate biosynthesis

Diseases

Associated diseases	References
Stomach cancer	PMID:23808167
Arteriosclerosis	PMID:16127462
hepatocellular carcinoma	PMID:19422879
Cataract	PMID:21329682
Diabetic retinopathy	PMID:19587357
type 2 diabetes mellitus	PMID:15569136
Diabetic neuropathy	PMID:9489533
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)