• Gene id: 2309

Gene Summary

• Gene Symbol: FOXO3   Gene   UCSC   Ensembl
• Aliases: AF6q21, FKHRL1, FKHRL1P2, FOXO2, FOXO3A
• Gene name: forkhead box O3
• Alternate names: forkhead box protein O3, forkhead box O3A, forkhead homolog (rhabdomyosarcoma) like 1, forkhead in rhabdomyosarcoma-like 1, forkhead, Drosophila, homolog of, in rhabdomyosarcoma-like 1,
• Gene location: 6q21 (108559824: 108684773)     Exons: 9     NC_000006.12
• Gene summary(Entrez): This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. This gene likely functions as a trigger for apoptosis through expression of genes necessary for cell death. Translocation of this gene
• OMIM: 609701

Protein Summary

• Protein general information: O43524  
  • Name: Forkhead box protein O3 (AF6q21 protein) (Forkhead in rhabdomyosarcoma like 1)
  • Length: 673  
  • Mass: 71277
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MAEAPASPAPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQASPAKPSGETAADSMIPEEEDDEDDEDGGGRAGS
  AMAIGGGGGSGTLGSGLLLEDSARVLAPGGQDPGSGPATAAGGLSGGTQALLQPQQPLPPPQPGAAGGSGQPRKC
  SSRRNAWGNLSYADLITRAIESSPDKRLTLSQIYEWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSLHSRFMRVQN
  EGTGKSSWWIINPDGGKSGKAPRRRAVSMDNSNKYTKSRGRAAKKKAALQTAPESADDSPSQLSKWPGSPTSRSS
  DELDAWTDFRSRTNSNASTVSGRLSPIMASTELDEVQDDDAPLSPMLYSSSASLSPSVSKPCTVELPRLTDMAGT
  MNLNDGLTENLMDDLLDNITLPPSQPSPTGGLMQRSSSFPYTTKGSGLGSPTSSFNSTVFGPSSLNSLRQSPMQT
  IQENKPATFSSMSHYGNQTLQDLLTSDSLSHSDVMMTQSDPLMSQASTAVSAQNSRRNVMLRNDPMMSFAAQPNQ
  GSLVNQNLLHHQHQTQGALGGSRALSNSVSNMGLSESSSLGSAKHQQQSPVSQSMQTLSDSLSGSSLYSTSANLP
  VMGHEKFPSDLDLDMFNGSLECDMESIIRSELMDADGLDFNFDSLISTQNVVGLNVGNFTGAKQASSQSWVPG

• Structural information:
  • Interpro: IPR001766  IPR032067  IPR032068  IPR030456  IPR036388   IPR036390  
  • Prosite: PS00658 PS50039
  • CDD: cd00059
  • PDB: 2K86 2LQH 2LQI 2UZK 6MNL
  • PDBsum: 2K86 2LQH 2LQI 2UZK 6MNL
  • DIP: 29723
  • STRING: ENSP00000385824
• Other Databases: GeneCards:  FOXO3  Malacards:  FOXO3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008013	beta-catenin binding	IPI	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0008134	transcription factor binding	IBA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0003700	DNA-binding transcription factor activity	IBA	molecular function
GO:0008286	insulin receptor signaling pathway	IBA	biological process
GO:0042593	glucose homeostasis	IBA	biological process
GO:0043565	sequence-specific DNA binding	IBA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0006417	regulation of translation	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0003677	DNA binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0034599	cellular response to oxidative stress	ISS	biological process
GO:0006357	regulation of transcription by RNA polymerase II	ISS	biological process
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	ISS	molecular function
GO:0042594	response to starvation	ISS	biological process
GO:0033209	tumor necrosis factor-mediated signaling pathway	IMP	biological process
GO:0070542	response to fatty acid	ISS	biological process
GO:0031490	chromatin DNA binding	ISS	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0014737	positive regulation of muscle atrophy	ISS	biological process
GO:0010508	positive regulation of autophagy	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0045648	positive regulation of erythrocyte differentiation	IDA	biological process
GO:0003700	DNA-binding transcription factor activity	IDA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000177	regulation of neural precursor cell proliferation	IEA	biological process
GO:0048854	brain morphogenesis	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0042594	response to starvation	IEA	biological process
GO:0042593	glucose homeostasis	IEA	biological process
GO:0034599	cellular response to oxidative stress	IEA	biological process
GO:0032991	protein-containing complex	IEA	cellular component
GO:0006390	mitochondrial transcription	IEA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0001556	oocyte maturation	IEA	biological process
GO:0001547	antral ovarian follicle growth	IEA	biological process
GO:0001544	initiation of primordial ovarian follicle growth	IEA	biological process
GO:0001542	ovulation from ovarian follicle	IEA	biological process
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0000976	transcription regulatory region sequence-specific DNA binding	IEA	molecular function
GO:1990090	cellular response to nerve growth factor stimulus	IEA	biological process
GO:1904646	cellular response to amyloid-beta	IEA	biological process
GO:1901300	positive regulation of hydrogen peroxide-mediated programmed cell death	IEA	biological process
GO:0071548	response to dexamethasone	IEA	biological process
GO:0071456	cellular response to hypoxia	IEA	biological process
GO:0071333	cellular response to glucose stimulus	IEA	biological process
GO:0007568	aging	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0001221	transcription cofactor binding	IEA	molecular function
GO:2000377	regulation of reactive oxygen species metabolic process	IEA	biological process
GO:1902895	positive regulation of pri-miRNA transcription by RNA polymerase II	IEA	biological process
GO:0097192	extrinsic apoptotic signaling pathway in absence of ligand	IEA	biological process
GO:0097150	neuronal stem cell population maintenance	IEA	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0034246	mitochondrial sequence-specific DNA-binding transcription factor activity	IEA	molecular function
GO:0031490	chromatin DNA binding	IEA	molecular function
GO:0030330	DNA damage response, signal transduction by p53 class mediator	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0014737	positive regulation of muscle atrophy	IEA	biological process
GO:0010508	positive regulation of autophagy	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA	molecular function
GO:2000353	positive regulation of endothelial cell apoptotic process	IEA	biological process
GO:1990785	response to water-immersion restraint stress	IEA	biological process
GO:1903428	positive regulation of reactive oxygen species biosynthetic process	IEA	biological process
GO:0071386	cellular response to corticosterone stimulus	IEA	biological process
GO:0045665	negative regulation of neuron differentiation	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0031667	response to nutrient levels	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0043065	positive regulation of apoptotic process	IDA	biological process
GO:0030336	negative regulation of cell migration	IMP	biological process
GO:0000976	transcription regulatory region sequence-specific DNA binding	ISS	molecular function
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	ISS	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IMP	biological process
GO:1902895	positive regulation of pri-miRNA transcription by RNA polymerase II	ISS	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005741	mitochondrial outer membrane	IDA	cellular component
GO:0005759	mitochondrial matrix	IDA	colocalizes with
GO:0005634	nucleus	IDA	cellular component
GO:0042149	cellular response to glucose starvation	IDA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0043565	sequence-specific DNA binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	IDA	colocalizes with
GO:0034246	mitochondrial sequence-specific DNA-binding transcription factor activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006390	mitochondrial transcription	IMP	biological process
GO:0043525	positive regulation of neuron apoptotic process	IMP	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0005634	nucleus	IMP	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa05131	Shigellosis
hsa04062	Chemokine signaling pathway
hsa04218	Cellular senescence
hsa04722	Neurotrophin signaling pathway
hsa04152	AMPK signaling pathway
hsa04068	FoxO signaling pathway
hsa04211	Longevity regulating pathway
hsa04137	Mitophagy - animal
hsa01521	EGFR tyrosine kinase inhibitor resistance
hsa04917	Prolactin signaling pathway
hsa05223	Non-small cell lung cancer
hsa04213	Longevity regulating pathway - multiple species
hsa05213	Endometrial cancer
P06959	CCKR signaling map

Diseases

Associated diseases	References
Prostate cancer	PMID:18336616
Alzheimer's disease	PMID:23153928
Alzheimer's disease	PMID:23585551
Endometrial adenocarcinoma	PMID:26045339
Temporal lobe epilepsy	PMID:23278239
Rheumatoid arthritis	PMID:19435720
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq