• Gene id: 2308

Gene Summary

• Gene Symbol: FOXO1   Gene   UCSC   Ensembl
• Aliases: FKH1, FKHR, FOXO1A
• Gene name: forkhead box O1
• Alternate names: forkhead box protein O1, forkhead box protein O1A, forkhead, Drosophila, homolog of, in rhabdomyosarcoma,
• Gene location: 13q14.11 (40666596: 40555663)     Exons: 5     NC_000013.11
• Gene summary(Entrez): This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in myogenic growth and differentiation. T
• OMIM: 136533

Protein Summary

• Protein general information: Q12778  
  • Name: Forkhead box protein O1 (Forkhead box protein O1A) (Forkhead in rhabdomyosarcoma)
  • Length: 655  
  • Mass: 69,662
• Sequence:

  MAEAPQVVEIDPDFEPLPRPRSCTWPLPRPEFSQSNSATSSPAPSGSAAANPDAAAGLPSASAAAVSADFMSNLS
  LLEESEDFPQAPGSVAAAVAAAAAAAATGGLCGDFQGPEAGCLHPAPPQPPPPGPLSQHPPVPPAAAGPLAGQPR
  KSSSSRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIR
  VQNEGTGKSSWWMLNPEGGKSGKSPRRRAASMDNNSKFAKSRSRAAKKKASLQSGQEGAGDSPGSQFSKWPASPG
  SHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPPSAAKMASTLPSLSEISNPENMENLL
  DNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSPNYQKYTYGQSSMSPLPQMPIQTLQDNKSSYG
  GMSQYNCAPGLLKELLTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHP
  GHAQQTSAVNGRPLPHTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPS
  DLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG

• Structural information:
  • Interpro: IPR001766  IPR032067  IPR032068  IPR030456  IPR036388   IPR036390  
  • Prosite: PS00658 PS50039
  • CDD: cd00059
  • PDB: 3CO6 3CO7 3COA 4LG0 5DUI
  • PDBsum: 3CO6 3CO7 3COA 4LG0 5DUI
  • DIP: 35654
  • STRING: ENSP00000368880
• Other Databases: GeneCards:  FOXO1  Malacards:  FOXO1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0000981	RNA polymerase II transcription factor activity, sequence-specific DNA binding	IBA	molecular function
GO:0000989	transcription factor activity, transcription factor binding	IEA	molecular function
GO:0001078	transcriptional repressor activity, RNA polymerase II core promoter proximal region sequence-specific binding	IEA	molecular function
GO:0001223	transcription coactivator binding	IEA	molecular function
GO:0001568	blood vessel development	IEA	biological process
GO:0001659	temperature homeostasis	ISS	biological process
GO:0001678	cellular glucose homeostasis	ISS	biological process
GO:0003682	chromatin binding	ISS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	ISS	cellular component
GO:0005829	cytosol	ISS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006473	protein acetylation	ISS	biological process
GO:0006914	autophagy	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	ISS	biological process
GO:0008013	beta-catenin binding	IDA	molecular function
GO:0008286	insulin receptor signaling pathway	ISS	biological process
GO:0009267	cellular response to starvation	IDA	biological process
GO:0009267	cellular response to starvation	ISS	biological process
GO:0010508	positive regulation of autophagy	IMP	biological process
GO:0031018	endocrine pancreas development	TAS	biological process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0032869	cellular response to insulin stimulus	ISS	biological process
GO:0032873	negative regulation of stress-activated MAPK cascade	IDA	biological process
GO:0034599	cellular response to oxidative stress	ISS	biological process
GO:0035947	regulation of gluconeogenesis by regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0043065	positive regulation of apoptotic process	IMP	biological process
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0043565	sequence-specific DNA binding	IDA	molecular function
GO:0045444	fat cell differentiation	ISS	biological process
GO:0045599	negative regulation of fat cell differentiation	ISS	biological process
GO:0045599	negative regulation of fat cell differentiation	ISS	biological process
GO:0045722	positive regulation of gluconeogenesis	IEA	biological process
GO:0045732	positive regulation of protein catabolic process	IMP	biological process
GO:0045892	negative regulation of transcription, DNA-templated	ISS	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0051721	protein phosphatase 2A binding	ISS	molecular function
GO:0070166	enamel mineralization	IEA	biological process
GO:0070301	cellular response to hydrogen peroxide	IEA	biological process
GO:0070417	cellular response to cold	ISS	biological process
GO:0071455	cellular response to hyperoxia	IDA	biological process
GO:0071549	cellular response to dexamethasone stimulus	IEA	biological process
GO:0071732	cellular response to nitric oxide	ISS	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0097150	neuronal stem cell population maintenance	IEA	biological process
GO:1902617	response to fluoride	IEA	biological process
GO:2000177	regulation of neural precursor cell proliferation	IEA	biological process
GO:2000377	regulation of reactive oxygen species metabolic process	IEA	biological process
GO:2000505	regulation of energy homeostasis	ISS	biological process
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0000981	RNA polymerase II transcription factor activity, sequence-specific DNA binding	IBA	molecular function
GO:0000989	transcription factor activity, transcription factor binding	IEA	molecular function
GO:0001078	transcriptional repressor activity, RNA polymerase II core promoter proximal region sequence-specific binding	IEA	molecular function
GO:0001223	transcription coactivator binding	IEA	molecular function
GO:0001227	transcriptional repressor activity, RNA polymerase II transcription regulatory region sequence-specific binding	IEA	molecular function
GO:0001568	blood vessel development	IEA	biological process
GO:0001659	temperature homeostasis	ISS	biological process
GO:0001678	cellular glucose homeostasis	ISS	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003682	chromatin binding	ISS	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	IEA	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	ISS	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	ISS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006357	regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0006473	protein acetylation	ISS	biological process
GO:0006914	autophagy	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	ISS	biological process
GO:0008013	beta-catenin binding	IDA	molecular function
GO:0008134	transcription factor binding	IEA	molecular function
GO:0008286	insulin receptor signaling pathway	IEA	biological process
GO:0008286	insulin receptor signaling pathway	ISS	biological process
GO:0009267	cellular response to starvation	IDA	biological process
GO:0009267	cellular response to starvation	ISS	biological process
GO:0010508	positive regulation of autophagy	IMP	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0031018	endocrine pancreas development	TAS	biological process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0032868	response to insulin	IEA	biological process
GO:0032869	cellular response to insulin stimulus	IEA	biological process
GO:0032869	cellular response to insulin stimulus	ISS	biological process
GO:0032873	negative regulation of stress-activated MAPK cascade	IDA	biological process
GO:0034599	cellular response to oxidative stress	IEA	biological process
GO:0034599	cellular response to oxidative stress	ISS	biological process
GO:0035947	regulation of gluconeogenesis by regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0042127	regulation of cell proliferation	IEA	biological process
GO:0042593	glucose homeostasis	IEA	biological process
GO:0043065	positive regulation of apoptotic process	IMP	biological process
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0043565	sequence-specific DNA binding	IDA	molecular function
GO:0045444	fat cell differentiation	ISS	biological process
GO:0045599	negative regulation of fat cell differentiation	IEA	biological process
GO:0045599	negative regulation of fat cell differentiation	ISS	biological process
GO:0045599	negative regulation of fat cell differentiation	ISS	biological process
GO:0045722	positive regulation of gluconeogenesis	IEA	biological process
GO:0045732	positive regulation of protein catabolic process	IMP	biological process
GO:0045892	negative regulation of transcription, DNA-templated	ISS	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0051721	protein phosphatase 2A binding	IEA	molecular function
GO:0051721	protein phosphatase 2A binding	ISS	molecular function
GO:0070166	enamel mineralization	IEA	biological process
GO:0070301	cellular response to hydrogen peroxide	IEA	biological process
GO:0070417	cellular response to cold	ISS	biological process
GO:0071455	cellular response to hyperoxia	IDA	biological process
GO:0071549	cellular response to dexamethasone stimulus	IEA	biological process
GO:0071732	cellular response to nitric oxide	IEA	biological process
GO:0071732	cellular response to nitric oxide	ISS	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0097150	neuronal stem cell population maintenance	IEA	biological process
GO:1902617	response to fluoride	IEA	biological process
GO:2000177	regulation of neural precursor cell proliferation	IEA	biological process
GO:2000377	regulation of reactive oxygen species metabolic process	IEA	biological process
GO:2000505	regulation of energy homeostasis	ISS	biological process
GO:0000981	RNA polymerase II transcription factor activity, sequence-specific DNA binding	IBA	molecular function
GO:0001659	temperature homeostasis	ISS	biological process
GO:0001678	cellular glucose homeostasis	ISS	biological process
GO:0003682	chromatin binding	ISS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	ISS	cellular component
GO:0005829	cytosol	ISS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006473	protein acetylation	ISS	biological process
GO:0006974	cellular response to DNA damage stimulus	ISS	biological process
GO:0008013	beta-catenin binding	IDA	molecular function
GO:0008286	insulin receptor signaling pathway	ISS	biological process
GO:0009267	cellular response to starvation	IDA	biological process
GO:0009267	cellular response to starvation	ISS	biological process
GO:0010508	positive regulation of autophagy	IMP	biological process
GO:0031018	endocrine pancreas development	TAS	biological process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0032869	cellular response to insulin stimulus	ISS	biological process
GO:0032873	negative regulation of stress-activated MAPK cascade	IDA	biological process
GO:0034599	cellular response to oxidative stress	ISS	biological process
GO:0043065	positive regulation of apoptotic process	IMP	biological process
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0043565	sequence-specific DNA binding	IDA	molecular function
GO:0045444	fat cell differentiation	ISS	biological process
GO:0045599	negative regulation of fat cell differentiation	ISS	biological process
GO:0045599	negative regulation of fat cell differentiation	ISS	biological process
GO:0045732	positive regulation of protein catabolic process	IMP	biological process
GO:0045892	negative regulation of transcription, DNA-templated	ISS	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0051721	protein phosphatase 2A binding	ISS	molecular function
GO:0070417	cellular response to cold	ISS	biological process
GO:0071455	cellular response to hyperoxia	IDA	biological process
GO:0071732	cellular response to nitric oxide	ISS	biological process
GO:2000505	regulation of energy homeostasis	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04068	FoxO signaling pathway
hsa04152	AMPK signaling pathway
hsa04218	Cellular senescence
hsa04910	Insulin signaling pathway
hsa04922	Glucagon signaling pathway
hsa04919	Thyroid hormone signaling pathway
hsa04211	Longevity regulating pathway
hsa04213	Longevity regulating pathway - multiple species
hsa05200	Pathways in cancer
hsa05202	Transcriptional misregulation in cancer
hsa05215	Prostate cancer
hsa04931	Insulin resistance
hsa04933	AGE-RAGE signaling pathway in diabetic complications
hsa05165	Human papillomavirus infection

Diseases

Associated diseases	References
Cancer (head and neck)	GAD: 20819778
Alveolar rhabdomyosarcoma	KEGG: H00037
Atherosclerosis	GAD: 19948975
Insulin resistance	GAD: 14980718
Diabetes	GAD: 16497530
Autism	GAD: 19058789
Polycystic ovary syndrome (PCOS)	INFBASE: 20406953
Endometrial decidualization	INFBASE: 16709600
Endometriosis	INFBASE: 15501904
Female infertility	INFBASE: 17510236
Male factor infertility	MIK: 24184258
Cryptorchidism	MIK: 24184258
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 24184258
Spermatogenic defects	MIK: 21865646
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24184258	Cryptorchidism, undescended testes				Male infertility
21865646	Maintanence and initiation of spermatogenesis				Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray