• Gene id: 2305

Gene Summary

• Gene Symbol: FOXM1   Gene   UCSC   Ensembl
• Aliases: FKHL16, FOXM1A, FOXM1B, FOXM1C, HFH-11, HFH11, HNF-3, INS-1, MPHOSPH2, MPP-2, MPP2, PIG29, TRIDENT
• Gene name: forkhead box M1
• Alternate names: forkhead box protein M1, Forkhead, drosophila, homolog-like 16, HNF-3/fork-head homolog 11, M-phase phosphoprotein 2, MPM-2 reactive phosphoprotein 2, a novel forkhead box M1 isoform FOXM1D, forkhead-related protein FKHL16, hepatocyte nuclear factor 3 for,
• Gene location: 12p13.33 (2877154: 2857679)     Exons: 11     NC_000012.12
• Gene summary(Entrez): The protein encoded by this gene is a transcriptional activator involved in cell proliferation. The encoded protein is phosphorylated in M phase and regulates the expression of several cell cycle genes, such as cyclin B1 and cyclin D1. Several transcript
• OMIM: 602341

Protein Summary

• Protein general information: Q08050  
  • Name: Forkhead box protein M1 (Forkhead related protein FKHL16) (Hepatocyte nuclear factor 3 forkhead homolog 11) (HFH 11) (HNF 3/fork head homolog 11) (M phase phosphoprotein 2) (MPM 2 reactive phosphoprotein 2) (Transcription factor Trident) (Winged helix fac
  • Length: 763  
  • Mass: 84,283
• Sequence:

  MKTSPRRPLILKRRRLPLPVQNAPSETSEEEPKRSPAQQESNQAEASKEVAESNSCKFPAGIKIINHPTMPNTQV
  VAIPNNANIHSIITALTAKGKESGSSGPNKFILISCGGAPTQPPGLRPQTQTSYDAKRTEVTLETLGPKPAARDV
  NLPRPPGALCEQKRETCADGEAAGCTINNSLSNIQWLRKMSSDGLGSRSIKQEMEEKENCHLEQRQVKVEEPSRP
  SASWQNSVSERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVRETS
  ANGKVSFWTIHPSANRYLTLDQVFKPLDPGSPQLPEHLESQQKRPNPELRRNMTIKTELPLGARRKMKPLLPRVS
  SYLVPIQFPVNQSLVLQPSVKVPLPLAASLMSSELARHSKRVRIAPKVLLAEEGIAPLSSAGPGKEEKLLFGEGF
  SPLLPVQTIKEEEIQPGEEMPHLARPIKVESPPLEEWPSPAPSFKEESSHSWEDSSQSPTPRPKKSYSGLRSPTR
  CVSEMLVIQHRERRERSRSRRKQHLLPPCVDEPELLFSEGPSTSRWAAELPFPADSSDPASQLSYSQEVGGPFKT
  PIKETLPISSTPSKSVLPRTPESWRLTPPAKVGGLDFSPVQTSQGASDPLPDPLGLMDLSTTPLQSAPPLESPQR
  LLSSEPLDLISVPFGNSSPSDIDVPKPGSPEPQVSGLAANRSLTEGLVLDTMNDSLSKILLDISFPGLDEDPLGP
  DNINWSQFIPELQ

• Structural information:
  • Interpro: IPR001766  IPR018122  IPR030456  IPR036388  IPR036390  
  • Prosite: PS00657 PS00658 PS50039
  • CDD: cd00059
  • PDB: 3G73
  • PDBsum: 3G73
  • DIP: 36754
  • STRING: ENSP00000342307
• Other Databases: GeneCards:  FOXM1  Malacards:  FOXM1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000086	G2/M transition of mitotic cell cycle	IDA	biological process
GO:0000086	G2/M transition of mitotic cell cycle	TAS	biological process
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IMP	biological process
GO:0000981	RNA polymerase II transcription factor activity, sequence-specific DNA binding	IBA	molecular function
GO:0001558	regulation of cell growth	TAS	biological process
GO:0003677	DNA binding	IDA	molecular function
GO:0003677	DNA binding	IDA	molecular function
GO:0003677	DNA binding	TAS	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	IDA	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	IDA	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0006281	DNA repair	IEA	biological process
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006366	transcription from RNA polymerase II promoter	IDA	biological process
GO:0006978	DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator	IMP	biological process
GO:0007049	cell cycle	TAS	biological process
GO:0008284	positive regulation of cell proliferation	IMP	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0032873	negative regulation of stress-activated MAPK cascade	IMP	biological process
GO:0034698	response to gonadotropin	IEA	biological process
GO:0042127	regulation of cell proliferation	NAS	biological process
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IMP	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IMP	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IMP	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IMP	biological process
GO:0046578	regulation of Ras protein signal transduction	IMP	biological process
GO:0051591	response to cAMP	IEA	biological process
GO:0051726	regulation of cell cycle	TAS	biological process
GO:0071156	regulation of cell cycle arrest	IMP	biological process
GO:0090344	negative regulation of cell aging	IMP	biological process
GO:2000377	regulation of reactive oxygen species metabolic process	IMP	biological process
GO:2000781	positive regulation of double-strand break repair	IMP	biological process
GO:0000086	G2/M transition of mitotic cell cycle	IDA	biological process
GO:0000086	G2/M transition of mitotic cell cycle	TAS	biological process
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IMP	biological process
GO:0000981	RNA polymerase II transcription factor activity, sequence-specific DNA binding	IBA	molecular function
GO:0001558	regulation of cell growth	TAS	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	IDA	molecular function
GO:0003677	DNA binding	IDA	molecular function
GO:0003677	DNA binding	TAS	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	IEA	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	IDA	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	IDA	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0006281	DNA repair	IEA	biological process
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006366	transcription from RNA polymerase II promoter	IDA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0006978	DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator	IMP	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0007049	cell cycle	TAS	biological process
GO:0008284	positive regulation of cell proliferation	IMP	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0032873	negative regulation of stress-activated MAPK cascade	IMP	biological process
GO:0034698	response to gonadotropin	IEA	biological process
GO:0042127	regulation of cell proliferation	NAS	biological process
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IMP	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IMP	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IMP	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IMP	biological process
GO:0046578	regulation of Ras protein signal transduction	IMP	biological process
GO:0051591	response to cAMP	IEA	biological process
GO:0051726	regulation of cell cycle	TAS	biological process
GO:0071156	regulation of cell cycle arrest	IMP	biological process
GO:0090344	negative regulation of cell aging	IMP	biological process
GO:2000377	regulation of reactive oxygen species metabolic process	IMP	biological process
GO:2000781	positive regulation of double-strand break repair	IMP	biological process
GO:0000086	G2/M transition of mitotic cell cycle	IDA	biological process
GO:0000086	G2/M transition of mitotic cell cycle	TAS	biological process
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IMP	biological process
GO:0000981	RNA polymerase II transcription factor activity, sequence-specific DNA binding	IBA	molecular function
GO:0001558	regulation of cell growth	TAS	biological process
GO:0003677	DNA binding	IDA	molecular function
GO:0003677	DNA binding	IDA	molecular function
GO:0003677	DNA binding	TAS	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	IDA	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	IDA	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0006366	transcription from RNA polymerase II promoter	IDA	biological process
GO:0006978	DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator	IMP	biological process
GO:0007049	cell cycle	TAS	biological process
GO:0008284	positive regulation of cell proliferation	IMP	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0032873	negative regulation of stress-activated MAPK cascade	IMP	biological process
GO:0042127	regulation of cell proliferation	NAS	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IMP	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IMP	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IMP	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IMP	biological process
GO:0046578	regulation of Ras protein signal transduction	IMP	biological process
GO:0051726	regulation of cell cycle	TAS	biological process
GO:0071156	regulation of cell cycle arrest	IMP	biological process
GO:0090344	negative regulation of cell aging	IMP	biological process
GO:2000377	regulation of reactive oxygen species metabolic process	IMP	biological process
GO:2000781	positive regulation of double-strand break repair	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04218	Cellular senescence

Diseases

Associated diseases	References
Chronic renal failure	GAD: 21085059
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Azoospermia	MIK: 21933900
Asthenozoospermia	MIK: 21933900
Cryptorchidism	MIK: 28606200
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21933900	Azoospermia, asthenozoospermia			457 (289 infertile men (118 non obstructive azoospermia, 137 asthenozoospermia, 34 oligospermia), 168 age-matched fertile controls)	Male infertility	miR-509-5p
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray