• Gene id: 23039

Gene Summary

• Gene Symbol: XPO7   Gene   UCSC   Ensembl
• Aliases: EXP7, RANBP16
• Gene name: exportin 7
• Alternate names: exportin-7, RAN binding protein 16,
• Gene location: 8p21.3 (21919661: 22006584)     Exons: 6     NC_000008.11
• Gene summary(Entrez): The transport of protein and large RNAs through the nuclear pore complexes (NPC) is an energy-dependent and regulated process. The import of proteins with a nuclear localization signal (NLS) is accomplished by recognition of one or more clusters of basic
• OMIM: 606140

Protein Summary

• Protein general information: Q9UIA9  
  • Name: Exportin 7 (Exp7) (Ran binding protein 16)
  • Length: 1087  
  • Mass: 123907
  • Tissue specificity: Strong expression in testis, thyroid and bone marrow, low expression in lung, liver and small intestine, no expression in thymus, and remaining tissues studied have moderate expression. Expressed in red blood cells; overexpressed in re
• Sequence:

  MADHVQSLAQLENLCKQLYETTDTTTRLQAEKALVEFTNSPDCLSKCQLLLERGSSSYSQLLAATCLTKLVSRTN
  NPLPLEQRIDIRNYVLNYLATRPKLATFVTQALIQLYARITKLGWFDCQKDDYVFRNAITDVTRFLQDSVEYCII
  GVTILSQLTNEINQADTTHPLTKHRKIASSFRDSSLFDIFTLSCNLLKQASGKNLNLNDESQHGLLMQLLKLTHN
  CLNFDFIGTSTDESSDDLCTVQIPTSWRSAFLDSSTLQLFFDLYHSIPPSFSPLVLSCLVQIASVRRSLFNNAER
  AKFLSHLVDGVKRILENPQSLSDPNNYHEFCRLLARLKSNYQLGELVKVENYPEVIRLIANFTVTSLQHWEFAPN
  SVHYLLSLWQRLAASVPYVKATEPHMLETYTPEVTKAYITSRLESVHIILRDGLEDPLEDTGLVQQQLDQLSTIG
  RCEYEKTCALLVQLFDQSAQSYQELLQSASASPMDIAVQEGRLTWLVYIIGAVIGGRVSFASTDEQDAMDGELVC
  RVLQLMNLTDSRLAQAGNEKLELAMLSFFEQFRKIYIGDQVQKSSKLYRRLSEVLGLNDETMVLSVFIGKIITNL
  KYWGRCEPITSKTLQLLNDLSIGYSSVRKLVKLSAVQFMLNNHTSEHFSFLGINNQSNLTDMRCRTTFYTALGRL
  LMVDLGEDEDQYEQFMLPLTAAFEAVAQMFSTNSFNEQEAKRTLVGLVRDLRGIAFAFNAKTSFMMLFEWIYPSY
  MPILQRAIELWYHDPACTTPVLKLMAELVHNRSQRLQFDVSSPNGILLFRETSKMITMYGNRILTLGEVPKDQVY
  ALKLKGISICFSMLKAALSGSYVNFGVFRLYGDDALDNALQTFIKLLLSIPHSDLLDYPKLSQSYYSLLEVLTQD
  HMNFIASLEPHVIMYILSSISEGLTALDTMVCTGCCSCLDHIVTYLFKQLSRSTKKRTTPLNQESDRFLHIMQQH
  PEMIQQMLSTVLNIIIFEDCRNQWSMSRPLLGLILLNEKYFSDLRNSIVNSQPPEKQQAMHLCFENLMEGIERNL
  LTKNRDRFTQNLSAFRREVNDSMKNSTYGVNSNDMMS

• Structural information:
  • Protein Domains: (30..9-)
    (/note="Importin-N-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00115"-)
  • Interpro: IPR011989  IPR016024  IPR001494  IPR040021  
  • Prosite: PS50166
  • STRING: ENSP00000252512
• Other Databases: GeneCards:  XPO7  Malacards:  XPO7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006611	protein export from nucleus	IBA	biological process
GO:0005643	nuclear pore	IBA	cellular component
GO:0005049	nuclear export signal receptor activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0051169	nuclear transport	IEA	biological process
GO:0006886	intracellular protein transport	IEA	biological process
GO:0008536	Ran GTPase binding	IEA	molecular function
GO:0015031	protein transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005049	nuclear export signal receptor activity	IDA	molecular function
GO:0006611	protein export from nucleus	IDA	biological process
GO:0005643	nuclear pore	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray