• Gene id: 23029

Gene Summary

• Gene Symbol: RBM34   Gene   UCSC   Ensembl
• Gene name: RNA binding motif protein 34
• Alternate names: RNA-binding protein 34, epididymis secretory sperm binding protein,
• Gene location: 1q42.3 (235161279: 235131182)     Exons: 11     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the RNA-binding motif family of RNA recognition motif proteins. The encoded protein contains an RNA-binding domain made up of two RNA recognition motif subdomains referred to as RNA recognition motif-1 and RNA recognition mot
• OMIM: 618714

Protein Summary

• Protein general information: P42696  
  • Name: RNA binding protein 34 (RNA binding motif protein 34)
  • Length: 430  
  • Mass: 48565
• Sequence:

  MALEGMSKRKRKRSVQEGENPDDGVRGSPPEDYRLGQVASSLFRGEHHSRGGTGRLASLFSSLEPQIQPVYVPVP
  KQTIKKTKRNEEEESTSQIERPLSQEPAKKVKAKKKHTNAEKKLADRESALASADLEEEIHQKQGQKRKNSQPGV
  KVADRKILDDTEDTVVSQRKKIQINQEEERLKNERTVFVGNLPVTCNKKKLKSFFKEYGQIESVRFRSLIPAEGT
  LSKKLAAIKRKIHPDQKNINAYVVFKEESAATQALKRNGAQIADGFRIRVDLASETSSRDKRSVFVGNLPYKVEE
  SAIEKHFLDCGSIMAVRIVRDKMTGIGKGFGYVLFENTDSVHLALKLNNSELMGRKLRVMRSVNKEKFKQQNSNP
  RLKNVSKPKQGLNFTSKTAEGHPKSLFIGEKAVLLKTKKKGQKKSGRPKKQRKQK

• Structural information:
  • Protein Domains: (185..28-)
    (/note="RRM-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (287..36-)
    (/note="RRM-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
  • Interpro: IPR012677  IPR035979  IPR034220  IPR034221  IPR000504  
  • Prosite: PS50102
  • CDD: cd12394 cd12395
  • STRING: ENSP00000386226
• Other Databases: GeneCards:  RBM34  Malacards:  RBM34

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq