• Gene id: 23022

Gene Summary

• Gene Symbol: PALLD   Gene   UCSC   Ensembl
• Aliases: CGI-151, CGI151, MYN, PNCA1, SIH002
• Gene name: palladin, cytoskeletal associated protein
• Alternate names: palladin, myoneurin, sarcoma antigen NY-SAR-77,
• Gene location: 4q32.3 (110502139: 110491082)     Exons: 8     NC_000012.12
• Gene summary(Entrez): This gene encodes a cytoskeletal protein that is required for organizing the actin cytoskeleton. The protein is a component of actin-containing microfilaments, and it is involved in the control of cell shape, adhesion, and contraction. Polymorphisms in th
• OMIM: 608092

Protein Summary

• Protein general information: Q8WX93  
  • Name: Palladin (SIH002) (Sarcoma antigen NY SAR 77)
  • Length: 1383  
  • Mass: 150564
  • Tissue specificity: Detected in both muscle and non-muscle tissues. High expression in prostate, ovary, colon, and kidney. Not detected in spleen, skeletal muscle, lung and peripheral blood lymphocytes (at protein level). Protein is overexpressed in FA6,
• Sequence:

  MSGTSSHESFYDSLSDMQEESKNTDFFPGLSAFLSQEEINKSLDLARRAIADSETEDFDSEKEISQIFSTSPASL
  CEHPSHKETKLGEHASRRPQDNRSTPVQPLAEKQTKSISSPVSKRKPAMSPLLTRPSYIRSLRKAEKRGAKTPST
  NVKPKTPHQRKGGPQSQLCDKAANLIEELTSIFKAAKPRNRSPNGESSSPDSGYLSPKNQPSALLSASASQSPME
  DQGEMEREVKSPGARHCYQDNQDLAVPHNRKSHPQPHSALHFPAAPRFIQKLRSQEVAEGSRVYLECRVTGNPTP
  RVRWFCEGKELHNTPDIQIHCEGGDLHTLIIAEAFEDDTGRYTCLATNPSGSDTTSAEVFIEGASSTDSDSESLA
  FKSRAGAMPQAQKKTTSVSLTIGSSSPKTGVTTAVIQPLSVPVQQVHSPTSYLCRPDGTTTAYFPPVFTKELQNT
  AVAEGQVVVLECRVRGAPPLQVQWFRQGSEIQDSPDFRILQKKPRSTAEPEEICTLVIAETFPEDAGIFTCSARN
  DYGSATSTAQLVVTSANTENCSYESMGESNNDHFQHFPPPPPILETSSLELASKKPSEIQQVNNPELGLSRAALQ
  MQFNAAERETNGVHPSRGVNGLINGKANSNKSLPTPAVLLSPTKEPPPLLAKPKLDPLKLQQLQNQIRLEQEAGA
  RQPPPAPRSAPPSPPFPPPPAFPELAACTPPASPEPMSALASRSAPAMQSSGSFNYARPKQFIAAQNLGPASGHG
  TPASSPSSSSLPSPMSPTPRQFGRAPVPPFAQPFGAEPEAPWGSSSPSPPPPPPPVFSPTAAFPVPDVFPLPPPP
  PPLPSPGQASHCSSPATRFGHSQTPAAFLSALLPSQPPPAAVNALGLPKGVTPAGFPKKASRTARIASDEEIQGT
  KDAVIQDLERKLRFKEDLLNNGQPRLTYEERMARRLLGADSATVFNIQEPEEETANQEYKVSSCEQRLISEIEYR
  LERSPVDESGDEVQYGDVPVENGMAPFFEMKLKHYKIFEGMPVTFTCRVAGNPKPKIYWFKDGKQISPKSDHYTI
  QRDLDGTCSLHTTASTLDDDGNYTIMAANPQGRISCTGRLMVQAVNQRGRSPRSPSGHPHVRRPRSRSRDSGDEN
  EPIQERFFRPHFLQAPGDLTVQEGKLCRMDCKVSGLPTPDLSWQLDGKPVRPDSAHKMLVRENGVHSLIIEPVTS
  RDAGIYTCIATNRAGQNSFSLELVVAAKEAHKPPVFIEKLQNTGVADGYPVRLECRVLGVPPPQIFWKKENESLT
  HSTDRVSMHQDNHGYICLLIQGATKEDAGWYTVSAKNEAGIVSCTARLDVYTQWHQQSQSTKPKKVRPSASRYAA
  LSDQGLDIKAAFQPEANPSHLTLNTALVESEDL

• Structural information:
  • Protein Domains: (271..36-)
    1 (/note="Ig-like-C2-type)
    (440..53-)
    2 (/note="Ig-like-C2-type)
    (1001..108-)
    3 (/note="Ig-like-C2-type)
    (1135..122-)
    4 (/note="Ig-like-C2-type)
    (1233..132-)
    5" (/note="Ig-like-C2-type)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR013098  IPR003599   IPR003598  IPR033017  
  • Prosite: PS50835
  • CDD: cd05893
  • PDB: 2DM2 2DM3
  • PDBsum: 2DM2 2DM3
  • STRING: ENSP00000425556
• Other Databases: GeneCards:  PALLD  Malacards:  PALLD

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007010	cytoskeleton organization	NAS	biological process
GO:0051371	muscle alpha-actinin binding	TAS	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005884	actin filament	IDA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0007156	homophilic cell adhesion via plasma membrane adhesion molecules	IBA	biological process
GO:0007411	axon guidance	IBA	biological process
GO:0098632	cell-cell adhesion mediator activity	IBA	molecular function
GO:0030424	axon	IBA	cellular component
GO:0070593	dendrite self-avoidance	IBA	biological process
GO:0016477	cell migration	IEA	biological process
GO:0030036	actin cytoskeleton organization	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0007411	axon guidance	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0003779	actin binding	IEA	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0030036	actin cytoskeleton organization	IEA	biological process
GO:0030018	Z disc	IEA	cellular component
GO:0005925	focal adhesion	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0003382	epithelial cell morphogenesis	IEA	biological process
GO:0003334	keratinocyte development	IEA	biological process
GO:0001725	stress fiber	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0001726	ruffle	IEA	cellular component
GO:0030426	growth cone	IEA	cellular component
GO:0030018	Z disc	IEA	cellular component
GO:0002102	podosome	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005925	focal adhesion	IEA	cellular component
GO:0030027	lamellipodium	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0015629	actin cytoskeleton	IDA	cellular component
GO:0005925	focal adhesion	HDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0001725	stress fiber	IDA	cellular component
GO:0030018	Z disc	IDA	cellular component
GO:0030027	lamellipodium	IDA	cellular component
GO:0060076	excitatory synapse	ISS	cellular component

Diseases

Associated diseases	References
pancreatic cancer	PMID:20436683
pancreatic cancer	PMID:17194196
pancreatic ductal carcinoma	PMID:17404500
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray