• Gene id: 23017

Gene Summary

• Gene Symbol: FAIM2   Gene   UCSC   Ensembl
• Aliases: LFG, LFG2, NGP35, NMP35, TMBIM2
• Gene name: Fas apoptotic inhibitory molecule 2
• Alternate names: protein lifeguard 2, neural membrane protein 35, transmembrane BAX inhibitor motif-containing protein 2,
• Gene location: 12q13.12 (49903899: 49866895)     Exons: 13     NC_000012.12
• OMIM: 604306

Protein Summary

• Protein general information: Q9BWQ8  
  • Name: Protein lifeguard 2 (Fas apoptotic inhibitory molecule 2) (Neural membrane protein 35) (Transmembrane BAX inhibitor motif containing protein 2)
  • Length: 316  
  • Mass: 35110
  • Tissue specificity: Highly expressed in breast carcinoma tissues. Enhanced expression correlates with the grade of the tumor (grade II/grade III) in primary breast tumors (at protein level). Widely expressed. Expressed at high levels in the brain especial
• Sequence:

  MTQGKLSVANKAPGTEGQQQVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVDPSSSSS
  YDNGFPTGDHELFTTFSWDDQKVRRVFVRKVYTILLIQLLVTLAVVALFTFCDPVKDYVQANPGWYWASYAVFFA
  TYLTLACCSGPRRHFPWNLILLTVFTLSMAYLTGMLSSYYNTTSVLLCLGITALVCLSVTVFSFQTKFDFTSCQG
  VLFVLLMTLFFSGLILAILLPFQYVPWLHAVYAALGAGVFTLFLALDTQLLMGNRRHSLSPEEYIFGALNIYLDI
  IYIFTFFLQLFGTNRE

• Structural information:
  • Interpro: IPR006214  
  • STRING: ENSP00000321951
• Other Databases: GeneCards:  FAIM2  Malacards:  FAIM2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045121	membrane raft	IDA	cellular component
GO:0043523	regulation of neuron apoptotic process	IMP	biological process
GO:0021681	cerebellar granular layer development	ISS	biological process
GO:0021680	cerebellar Purkinje cell layer development	ISS	biological process
GO:0021549	cerebellum development	ISS	biological process
GO:0021702	cerebellar Purkinje cell differentiation	ISS	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007417	central nervous system development	IEA	biological process
GO:0002931	response to ischemia	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0021549	cerebellum development	IEA	biological process
GO:0021680	cerebellar Purkinje cell layer development	IEA	biological process
GO:0021681	cerebellar granular layer development	IEA	biological process
GO:0043523	regulation of neuron apoptotic process	IEA	biological process
GO:0045121	membrane raft	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0021702	cerebellar Purkinje cell differentiation	IEA	biological process
GO:0043524	negative regulation of neuron apoptotic process	IEA	biological process
GO:2001234	negative regulation of apoptotic signaling pathway	IEA	biological process
GO:0045121	membrane raft	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0043066	negative regulation of apoptotic process	NAS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R