About Us

Search Result


Gene id 23015
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol GOLGA8A   Gene   UCSC   Ensembl
Aliases CFAP286, FAP286, GM88, GOLGA8B
Gene name golgin A8 family member A
Alternate names golgin subfamily A member 8A, 88 kDa Golgi matrix protein, 88-kDa golgi protein, GM88 autoantigen, Golgin subfamily A member 8B, golgi autoantigen, golgin subfamily a, 8A, golgin-67,
Gene location 15q14 (34437807: 34379067)     Exons: 24     NC_000015.10
Gene summary(Entrez) The Golgi apparatus, which participates in glycosylation and transport of proteins and lipids in the secretory pathway, consists of a series of stacked, flattened membrane sacs referred to as cisternae. Interactions between the Golgi and microtubules are
OMIM 616180

Protein Summary

Protein general information A7E2F4  

Name: Golgin subfamily A member 8A (88 kDa Golgi matrix protein) (GM88) (GM88 autoantigen)

Length: 631  Mass: 70117

Sequence MLPVDGEERKSEGSDTEGDRTSPCAVSSATLKDLEVGGSGRRCSDPAGQPSNLLPQRGLGAPLPAETAHTQPSPN
DRSLYLSPKSSSASSSLHARQSPCQEQAAVLNSRSIKISRLNDTIKSLKQQKKQVEHQLEEEKKANNEKQKAERE
LEGQIQRLNTEKKKLNTDLYHMKHSLRYFEEESKDLAGRLQRSSQRIGELEWSLCAVAATQKKKPDGFSSRSKAL
LKRQLEQSIREQILLKGHVTQLKESLKEVQLERDQYAEQIKGERAQWQQRMRKMSQEVCTLKEEKKHDTHRVEEL
ERSLSRLKNQMAEPLPPDAPAVSSEVELQDLRKELERVAGELQAQVENNQCISLLNRGQKERLREQEERLQEQQE
RLREREKRLQQLAEPQSDLEELKHENKSALQLEQQVKELQEKLGQVMETLTSAEKEPEAAVPASGTGGESSGLMD
LLEEKADLREHVEKLELGFIQYRRERCHQKVHRLLTEPGDSAKDASPGGGHHQAGPGQGGEEGEAAGAAGDGVAA
CGSYSEGHGKFLAAARNPAAEPSPGAPAPQELGAADKHGDLCEASLTNSVEPAQGEAREGSSQDNPTAQPVVQLL
GEMQDHQEHPGLGSNCCVPCFCWAWLPRRRR
Structural information
Interpro:  IPR024858  
MINT:  
STRING:   ENSP00000352111
Other Databases GeneCards:  GOLGA8A  Malacards:  GOLGA8A

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0005794 Golgi apparatus
IBA cellular component
GO:0005801 cis-Golgi network
IBA cellular component
GO:0000137 Golgi cis cisterna
IBA cellular component
GO:0007030 Golgi organization
IBA biological process
GO:0032580 Golgi cisterna membrane
IBA cellular component
GO:0051225 spindle assembly
IBA NOT|biological process
GO:0005794 Golgi apparatus
IEA cellular component
GO:0005794 Golgi apparatus
IEA cellular component
GO:0016020 membrane
IEA cellular component
GO:0032580 Golgi cisterna membrane
IEA cellular component
GO:0005794 Golgi apparatus
IDA cellular component
GO:0005829 cytosol
IDA cellular component
Associated diseases References
Spermatogenic defects MIK: 31037746
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

13 (5 controls,
8 cases)
Male infertility GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
31037746 Spermatoge
nic defect
s

16 (1 control,
15 cases)
Male infertility GSE6023 analyzed using GEO2R
Show abstract