• Gene id: 23011

Gene Summary

• Gene Symbol: RAB21   Gene   UCSC   Ensembl
• Gene name: RAB21, member RAS oncogene family
• Alternate names: ras-related protein Rab-21, GTP-binding protein RAB21,
• Gene location: 12q21.1 (71754862: 71800285)     Exons: 7     NC_000012.12
• Gene summary(Entrez): This gene belongs to the Rab family of monomeric GTPases, which are involved in the control of cellular membrane traffic. The encoded protein plays a role in the targeted trafficking of integrins via its association with integrin alpha tails. As a consequ
• OMIM: 612398

Protein Summary

• Protein general information: Q9UL25  
  • Name: Ras related protein Rab 21
  • Length: 225  
  • Mass: 24348
  • Tissue specificity: Widely expressed. In jejunal tissue, predominantly expressed in the apical region of the epithelial cell layer of the villi, weak expression, if any, in the crypt epithelium. Capillary endothelium and some cell types in the lamina prop
• Sequence:

  MAAAGGGGGGAAAAGRAYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNLAIWDT
  AGQERFHALGPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESY
  AESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQPGTARRGVQIIDDEPQAQTSGGGCCSSG

• Structural information:
  • Interpro: IPR027417  IPR041833  IPR005225  IPR001806  IPR020849  
  • Prosite: PS51419
  • CDD: cd04123
  • PDB: 1YZT 1YZU 1Z08 1Z0I 2OT3
  • PDBsum: 1YZT 1YZU 1Z08 1Z0I 2OT3
  • DIP: 29349
  • STRING: ENSP00000261263
• Other Databases: GeneCards:  RAB21  Malacards:  RAB21

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032482	Rab protein signal transduction	IBA	biological process
GO:0012505	endomembrane system	IBA	cellular component
GO:0003924	GTPase activity	IBA	molecular function
GO:0006886	intracellular protein transport	IBA	biological process
GO:0005769	early endosome	IBA	cellular component
GO:0005802	trans-Golgi network	IDA	cellular component
GO:0017157	regulation of exocytosis	IDA	biological process
GO:0019003	GDP binding	IDA	molecular function
GO:0019003	GDP binding	IDA	molecular function
GO:0005525	GTP binding	IDA	molecular function
GO:0003924	GTPase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0032482	Rab protein signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0031901	early endosome membrane	TAS	cellular component
GO:0005768	endosome	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045202	synapse	IEA	cellular component
GO:0030516	regulation of axon extension	IEA	biological process
GO:0008089	anterograde axonal transport	IEA	biological process
GO:0050775	positive regulation of dendrite morphogenesis	IEA	biological process
GO:0043005	neuron projection	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0031901	early endosome membrane	IEA	cellular component
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0032154	cleavage furrow	IEA	cellular component
GO:1904115	axon cytoplasm	IEA	cellular component
GO:1904115	axon cytoplasm	IEA	cellular component
GO:1904115	axon cytoplasm	IEA	cellular component
GO:0009898	cytoplasmic side of plasma membrane	IDA	cellular component
GO:0098559	cytoplasmic side of early endosome membrane	IDA	cellular component
GO:0032580	Golgi cisterna membrane	IDA	cellular component
GO:0012506	vesicle membrane	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005525	GTP binding	IMP	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:2000643	positive regulation of early endosome to late endosome transport	IMP	biological process
GO:0048260	positive regulation of receptor-mediated endocytosis	IMP	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005925	focal adhesion	HDA	cellular component
GO:0008089	anterograde axonal transport	IMP	biological process
GO:0008089	anterograde axonal transport	IDA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R