• Gene id: 230

Gene Summary

• Gene Symbol: ALDOC   Gene   UCSC   Ensembl
• Aliases: ALDC
• Gene name: aldolase, fructose-bisphosphate C
• Alternate names: fructose-bisphosphate aldolase C, aldolase 3, aldolase C, fructose-bisphosphate, brain-type aldolase, epididymis secretory sperm binding protein, fructoaldolase C, fructose-1,6-biphosphate triosephosphate lyase,
• Gene location: 17q11.2 (28576962: 28573114)     Exons: 10     NC_000017.11
• Gene summary(Entrez): This gene encodes a member of the class I fructose-biphosphate aldolase gene family. Expressed specifically in the hippocampus and Purkinje cells of the brain, the encoded protein is a glycolytic enzyme that catalyzes the reversible aldol cleavage of fruc
• OMIM: 601408

Protein Summary

• Protein general information: P09972  
  • Name: Fructose bisphosphate aldolase C (EC 4.1.2.13) (Brain type aldolase)
  • Length: 364  
  • Mass: 39456
• Sequence:

  MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRVKKCIG
  GVIFFHETLYQKDDNGVPFVRTIQDKGIVVGIKVDKGVVPLAGTDGETTTQGLDGLSERCAQYKKDGADFAKWRC
  VLKISERTPSALAILENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVYLE
  GTLLKPNMVTPGHACPIKYTPEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEASFNLNAINRCPLPRPWALTF
  SYGRALQASALNAWRGQRDNAGAATEEFIKRAEVNGLAAQGKYEGSGEDGGAAAQSLYIANHAY

• Structural information:
  • Interpro: IPR029768  IPR013785  IPR000741  
  • Prosite: PS00158
  • PDB: 1XFB
  • PDBsum: 1XFB
  • STRING: ENSP00000226253
• Other Databases: GeneCards:  ALDOC  Malacards:  ALDOC

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IBA	cellular component
GO:0004332	fructose-bisphosphate aldolase activity	IBA	molecular function
GO:0006096	glycolytic process	IBA	biological process
GO:0030388	fructose 1,6-bisphosphate metabolic process	IBA	biological process
GO:0030388	fructose 1,6-bisphosphate metabolic process	IDA	biological process
GO:0004332	fructose-bisphosphate aldolase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0004332	fructose-bisphosphate aldolase activity	IEA	molecular function
GO:0006096	glycolytic process	IEA	biological process
GO:0016829	lyase activity	IEA	molecular function
GO:0006096	glycolytic process	IEA	biological process
GO:0006000	fructose metabolic process	TAS	biological process
GO:0004332	fructose-bisphosphate aldolase activity	IEA	molecular function
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0061621	canonical glycolysis	TAS	biological process
GO:1904724	tertiary granule lumen	TAS	cellular component
GO:1904813	ficolin-1-rich granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006094	gluconeogenesis	TAS	biological process
GO:0034774	secretory granule lumen	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008092	cytoskeletal protein binding	IDA	molecular function
GO:0004332	fructose-bisphosphate aldolase activity	IDA	molecular function
GO:0005856	cytoskeleton	IC	cellular component
GO:0030388	fructose 1,6-bisphosphate metabolic process	IDA	biological process
GO:0006096	glycolytic process	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0030855	epithelial cell differentiation	IEP	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa01200	Carbon metabolism
hsa04066	HIF-1 signaling pathway
hsa01230	Biosynthesis of amino acids
hsa00010	Glycolysis / Gluconeogenesis
hsa00051	Fructose and mannose metabolism
hsa00030	Pentose phosphate pathway

Diseases

Associated diseases	References
Autoimmune disease of the nervous system	PMID:16356555
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881