• Gene id: 22992

Gene Summary

• Gene Symbol: KDM2A   Gene   UCSC   Ensembl
• Aliases: CXXC8, FBL11, FBL7, FBXL11, JHDM1A, LILINA
• Gene name: lysine demethylase 2A
• Alternate names: lysine-specific demethylase 2A, CXXC-type zinc finger protein 8, F-box and leucine-rich repeat protein 11, F-box/LRR-repeat protein 11, [Histone-H3]-lysine-36 demethylase 1A, jmjC domain-containing histone demethylation protein 1A, jumonji C domain-containing h,
• Gene location: 11q13.2 (67119262: 67258081)     Exons: 25     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), w
• OMIM: 605657

Protein Summary

• Protein general information: Q9Y2K7  
  • Name: Lysine specific demethylase 2A (EC 1.14.11.27) (CXXC type zinc finger protein 8) (F box and leucine rich repeat protein 11) (F box protein FBL7) (F box protein Lilina) (F box/LRR repeat protein 11) (JmjC domain containing histone demethylation protein 1A)
  • Length: 1162  
  • Mass: 132793
  • Tissue specificity: Widely expressed, with highest levels in brain, testis and ovary, followed by lung. {ECO
• Sequence:

  MEPEEERIRYSQRLRGTMRRRYEDDGISDDEIEGKRTFDLEEKLHTNKYNANFVTFMEGKDFNVEYIQRGGLRDP
  LIFKNSDGLGIKMPDPDFTVNDVKMCVGSRRMVDVMDVNTQKGIEMTMAQWTRYYETPEEEREKLYNVISLEFSH
  TRLENMVQRPSTVDFIDWVDNMWPRHLKESQTESTNAILEMQYPKVQKYCLMSVRGCYTDFHVDFGGTSVWYHIH
  QGGKVFWLIPPTAHNLELYENWLLSGKQGDIFLGDRVSDCQRIELKQGYTFVIPSGWIHAVYTPTDTLVFGGNFL
  HSFNIPMQLKIYNIEDRTRVPNKFRYPFYYEMCWYVLERYVYCITNRSHLTKEFQKESLSMDLELNGLESGNGDE
  EAVDREPRRLSSRRSVLTSPVANGVNLDYDGLGKTCRSLPSLKKTLAGDSSSDCSRGSHNGQVWDPQCAPRKDRQ
  VHLTHFELEGLRCLVDKLESLPLHKKCVPTGIEDEDALIADVKILLEELANSDPKLALTGVPIVQWPKRDKLKFP
  TRPKVRVPTIPITKPHTMKPAPRLTPVRPAAASPIVSGARRRRVRCRKCKACVQGECGVCHYCRDMKKFGGPGRM
  KQSCVLRQCLAPRLPHSVTCSLCGEVDQNEETQDFEKKLMECCICNEIVHPGCLQMDGEGLLNEELPNCWECPKC
  YQEDSSEKAQKRKMEESDEEAVQAKVLRPLRSCDEPLTPPPHSPTSMLQLIHDPVSPRGMVTRSSPGAGPSDHHS
  ASRDERFKRRQLLRLQATERTMVREKENNPSGKKELSEVEKAKIRGSYLTVTLQRPTKELHGTSIVPKLQAITAS
  SANLRHSPRVLVQHCPARTPQRGDEEGLGGEEEEEEEEEEEDDSAEEGGAARLNGRGSWAQDGDESWMQREVWMS
  VFRYLSRRELCECMRVCKTWYKWCCDKRLWTKIDLSRCKAIVPQALSGIIKRQPVSLDLSWTNISKKQLTWLVNR
  LPGLKDLLLAGCSWSAVSALSTSSCPLLRTLDLRWAVGIKDPQIRDLLTPPADKPGQDNRSKLRNMTDFRLAGLD
  ITDATLRLIIRHMPLLSRLDLSHCSHLTDQSSNLLTAVGSSTRYSLTELNMAGCNKLTDQTLIYLRRIANVTLID
  LRGCKQITRKACEHFISDLSINSLYCLSDEKLIQKIS

• Structural information:
  • Protein Domains: (148..31-)
    (/note="JmjC-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00538-)
    (889..93-)
    (/note="F-box"-)
  • Interpro: IPR001810  IPR041070  IPR003347  IPR006553  IPR032675   IPR019786  IPR002857  IPR011011  IPR001965  IPR019787  IPR013083  
  • Prosite: PS51184 PS51058 PS01359 PS50016
  • PDB: 2YU1 2YU2 4BBQ 6BYH 6C16
  • PDBsum: 2YU1 2YU2 4BBQ 6BYH 6C16
  • DIP: 34596
  • STRING: ENSP00000432786
• Other Databases: GeneCards:  KDM2A  Malacards:  KDM2A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008270	zinc ion binding	IDA	molecular function
GO:0045322	unmethylated CpG binding	IDA	molecular function
GO:0006303	double-strand break repair via nonhomologous end joining	IMP	biological process
GO:0070544	histone H3-K36 demethylation	IMP	biological process
GO:0051864	histone demethylase activity (H3-K36 specific)	IMP	molecular function
GO:0070544	histone H3-K36 demethylation	IMP	biological process
GO:0010944	negative regulation of transcription by competitive promoter binding	IMP	biological process
GO:0032922	circadian regulation of gene expression	IMP	biological process
GO:0042752	regulation of circadian rhythm	IMP	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0006325	chromatin organization	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0048511	rhythmic process	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0051213	dioxygenase activity	IEA	molecular function
GO:0051864	histone demethylase activity (H3-K36 specific)	IEA	molecular function
GO:0070544	histone H3-K36 demethylation	IMP	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005654	nucleoplasm	IEA	cellular component

Diseases

Associated diseases	References
lung non-small cell carcinoma	PMID:24200691
lung non-small cell carcinoma	PMID:24482232
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)