• Gene id: 22974

Gene Summary

• Gene Symbol: TPX2   Gene   UCSC   Ensembl
• Aliases: C20orf1, C20orf2, DIL-2, DIL2, FLS353, GD:C20orf1, HCA519, HCTP4, REPP86, p100
• Gene name: TPX2 microtubule nucleation factor
• Alternate names: targeting protein for Xklp2, TPX2, microtubule-associated protein homolog, TPX2, microtubule-associated, homolog, differentially expressed in cancerous and non-cancerous lung cells 2, differentially expressed in lung cells, hepatocellular carcinoma-associated ,
• Gene location: 20q11.21 (31739247: 31801801)     Exons: 18     NC_000020.11
• OMIM: 605917

Protein Summary

• Protein general information: Q9ULW0  
  • Name: Targeting protein for Xklp2 (Differentially expressed in cancerous and non cancerous lung cells 2) (DIL 2) (Hepatocellular carcinoma associated antigen 519) (Hepatocellular carcinoma associated antigen 90) (Protein fls353) (Restricted expression prolifera
  • Length: 747  
  • Mass: 85653
  • Tissue specificity: Expressed in lung carcinoma cell lines but not in normal lung tissues.
• Sequence:

  MSQVKSSYSYDAPSDFINFSSLDDEGDTQNIDSWFEEKANLENKLLGKNGTGGLFQGKTPLRKANLQQAIVTPLK
  PVDNTYYKEAEKENLVEQSIPSNACSSLEVEAAISRKTPAQPQRRSLRLSAQKDLEQKEKHHVKMKAKRCATPVI
  IDEILPSKKMKVSNNKKKPEEEGSAHQDTAEKNASSPEKAKGRHTVPCMPPAKQKFLKSTEEQELEKSMKMQQEV
  VEMRKKNEEFKKLALAGIGQPVKKSVSQVTKSVDFHFRTDERIKQHPKNQEEYKEVNFTSELRKHPSSPARVTKG
  CTIVKPFNLSQGKKRTFDETVSTYVPLAQQVEDFHKRTPNRYHLRSKKDDINLLPSKSSVTKICRDPQTPVLQTK
  HRARAVTCKSTAELEAEELEKLQQYKFKARELDPRILEGGPILPKKPPVKPPTEPIGFDLEIEKRIQERESKKKT
  EDEHFEFHSRPCPTKILEDVVGVPEKKVLPITVPKSPAFALKNRIRMPTKEDEEEDEPVVIKAQPVPHYGVPFKP
  QIPEARTVEICPFSFDSRDKERQLQKEKKIKELQKGEVPKFKALPLPHFDTINLPEKKVKNVTQIEPFCLETDRR
  GALKAQTWKHQLEEELRQQKEAACFKARPNTVISQEPFVPKKEKKSVAEGLSGSLVQEPFQLATEKRAKERQELE
  KRMAEVEAQKAQQLEEARLQEEEQKKEELARLRRELVHKANPIRKYQGLEIKSSDQPLTVPVSPKFSTRFHC

• Structural information:
  • Interpro: IPR015128  IPR027329  IPR027330  IPR009675  
  • PDB: 1OL5 3E5A 3HA6 4C3P 5LXM 6BJC
  • PDBsum: 1OL5 3E5A 3HA6 4C3P 5LXM 6BJC
  • DIP: 36727 46212
  • STRING: ENSP00000300403
• Other Databases: GeneCards:  TPX2  Malacards:  TPX2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000922	spindle pole	IDA	colocalizes with
GO:0007020	microtubule nucleation	IDA	biological process
GO:0007026	negative regulation of microtubule depolymerization	IDA	biological process
GO:0032147	activation of protein kinase activity	IDA	biological process
GO:0061676	importin-alpha family protein binding	IDA	molecular function
GO:0090307	mitotic spindle assembly	IDA	biological process
GO:0060236	regulation of mitotic spindle organization	ISS	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0005819	spindle	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005819	spindle	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0032147	activation of protein kinase activity	IEA	biological process
GO:0060236	regulation of mitotic spindle organization	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0005819	spindle	TAS	cellular component
GO:0000278	mitotic cell cycle	TAS	biological process
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0010389	regulation of G2/M transition of mitotic cell cycle	TAS	biological process
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0090307	mitotic spindle assembly	IEA	biological process
GO:0061676	importin-alpha family protein binding	IEA	molecular function
GO:0060236	regulation of mitotic spindle organization	IEA	biological process
GO:0043203	axon hillock	IEA	cellular component
GO:0019901	protein kinase binding	IEA	molecular function
GO:0005819	spindle	IEA	cellular component
GO:0019901	protein kinase binding	IPI	molecular function
GO:0032147	activation of protein kinase activity	IDA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0000922	spindle pole	IEA	cellular component
GO:0045171	intercellular bridge	IDA	cellular component
GO:0072686	mitotic spindle	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R