• Gene id: 22954

Gene Summary

• Gene Symbol: TRIM32   Gene   UCSC   Ensembl
• Aliases: BBS11, HT2A, LGMD2H, LGMDR8, TATIP
• Gene name: tripartite motif containing 32
• Alternate names: E3 ubiquitin-protein ligase TRIM32, 72 kDa Tat-interacting protein, RING-type E3 ubiquitin transferase TRIM32, TAT-interactive protein, 72-KD, tripartite motif-containing protein 32, zinc-finger protein HT2A,
• Gene location: 9q33.1 (116687301: 116701299)     Exons: 4     NC_000009.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The p
• OMIM: 602290

Protein Summary

• Protein general information: Q13049  
  • Name: E3 ubiquitin protein ligase TRIM32 (EC 2.3.2.27) (72 kDa Tat interacting protein) (RING type E3 ubiquitin transferase TRIM32) (Tripartite motif containing protein 32) (Zinc finger protein HT2A)
  • Length: 653  
  • Mass: 71989
  • Tissue specificity: Spleen, thymus, prostate, testis, ovary, intestine, colon and skeletal muscle. {ECO
• Sequence:

  MAAAAASHLNLDALREVLECPICMESFTEEQLRPKLLHCGHTICRQCLEKLLASSINGVRCPFCSKITRITSLTQ
  LTDNLTVLKIIDTAGLSEAVGLLMCRSCGRRLPRQFCRSCGLVLCEPCREADHQPPGHCTLPVKEAAEERRRDFG
  EKLTRLRELMGELQRRKAALEGVSKDLQARYKAVLQEYGHEERRVQDELARSRKFFTGSLAEVEKSNSQVVEEQS
  YLLNIAEVQAVSRCDYFLAKIKQADVALLEETADEEEPELTASLPRELTLQDVELLKVGHVGPLQIGQAVKKPRT
  VNVEDSWAMEATASAASTSVTFREMDMSPEEVVASPRASPAKQRGPEAASNIQQCLFLKKMGAKGSTPGMFNLPV
  SLYVTSQGEVLVADRGNYRIQVFTRKGFLKEIRRSPSGIDSFVLSFLGADLPNLTPLSVAMNCQGLIGVTDSYDN
  SLKVYTLDGHCVACHRSQLSKPWGITALPSGQFVVTDVEGGKLWCFTVDRGSGVVKYSCLCSAVRPKFVTCDAEG
  TVYFTQGLGLNLENRQNEHHLEGGFSIGSVGPDGQLGRQISHFFSENEDFRCIAGMCVDARGDLIVADSSRKEIL
  HFPKGGGYSVLIREGLTCPVGIALTPKGQLLVLDCWDHCIKIYSYHLRRYSTP

• Structural information:
  • Interpro: IPR011042  IPR001258  IPR013017  IPR027370  IPR000315   IPR001841  IPR013083  IPR017907  
  • Prosite: PS51125 PS50119 PS00518 PS50089
  • CDD: cd00021
  • PDB: 2CT2 5FEY
  • PDBsum: 2CT2 5FEY
  • STRING: ENSP00000408292
• Other Databases: GeneCards:  TRIM32  Malacards:  TRIM32

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0000209	protein polyubiquitination	IBA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0003713	transcription coactivator activity	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0032479	regulation of type I interferon production	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004842	ubiquitin-protein transferase activity	IEA	molecular function
GO:0007014	actin ubiquitination	IEA	biological process
GO:0031369	translation initiation factor binding	IEA	molecular function
GO:0034612	response to tumor necrosis factor	IEA	biological process
GO:0045444	fat cell differentiation	IEA	biological process
GO:0045666	positive regulation of neuron differentiation	IEA	biological process
GO:0045732	positive regulation of protein catabolic process	IEA	biological process
GO:0046716	muscle cell cellular homeostasis	IEA	biological process
GO:0050769	positive regulation of neurogenesis	IEA	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IEA	biological process
GO:0061564	axon development	IEA	biological process
GO:0061630	ubiquitin protein ligase activity	IEA	molecular function
GO:1903265	positive regulation of tumor necrosis factor-mediated signaling pathway	IEA	biological process
GO:2000147	positive regulation of cell motility	IEA	biological process
GO:0000209	protein polyubiquitination	IEA	biological process
GO:0001894	tissue homeostasis	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005863	striated muscle myosin thick filament	IEA	cellular component
GO:0009411	response to UV	IEA	biological process
GO:0016567	protein ubiquitination	IEA	biological process
GO:0017022	myosin binding	IEA	molecular function
GO:0048147	negative regulation of fibroblast proliferation	IEA	biological process
GO:0051155	positive regulation of striated muscle cell differentiation	IEA	biological process
GO:1903883	positive regulation of interleukin-17-mediated signaling pathway	IEA	biological process
GO:1903886	positive regulation of chemokine (C-C motif) ligand 20 production	IEA	biological process
GO:0061630	ubiquitin protein ligase activity	IDA	molecular function
GO:0031369	translation initiation factor binding	ISS	molecular function
GO:0003723	RNA binding	ISS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0017022	myosin binding	ISS	molecular function
GO:0030957	Tat protein binding	TAS	molecular function
GO:0030335	positive regulation of cell migration	IDA	biological process
GO:0045787	positive regulation of cell cycle	IDA	biological process
GO:0045862	positive regulation of proteolysis	IDA	biological process
GO:0034612	response to tumor necrosis factor	ISS	biological process
GO:0045087	innate immune response	TAS	biological process
GO:0045444	fat cell differentiation	ISS	biological process
GO:0045666	positive regulation of neuron differentiation	ISS	biological process
GO:0045732	positive regulation of protein catabolic process	ISS	biological process
GO:0050769	positive regulation of neurogenesis	ISS	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	ISS	biological process
GO:2000147	positive regulation of cell motility	ISS	biological process
GO:0000209	protein polyubiquitination	IDA	biological process
GO:0016567	protein ubiquitination	IDA	biological process
GO:0030307	positive regulation of cell growth	IDA	biological process
GO:1902230	negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage	IDA	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0005863	striated muscle myosin thick filament	ISS	colocalizes with
GO:0009411	response to UV	ISS	biological process
GO:0048147	negative regulation of fibroblast proliferation	ISS	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:1903508	positive regulation of nucleic acid-templated transcription	IEA	biological process
GO:0016567	protein ubiquitination	IEA	biological process
GO:1902187	negative regulation of viral release from host cell	IDA	biological process
GO:0045087	innate immune response	IDA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IDA	biological process
GO:0032897	negative regulation of viral transcription	IDA	biological process
GO:0043621	protein self-association	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0043130	ubiquitin binding	IDA	molecular function
GO:0051091	positive regulation of DNA-binding transcription factor activity	IDA	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04120	Ubiquitin mediated proteolysis

Diseases

Associated diseases	References
Limb-girdle muscular dystrophy	KEGG:H00593
Bardet-Biedl syndrome	KEGG:H00418
Limb-girdle muscular dystrophy	KEGG:H00593
Bardet-Biedl syndrome	KEGG:H00418
Bardet-Biedl syndrome	PMID:16606853
Muscular dystrophy	PMID:11822024
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)