• Gene id: 2295

Gene Summary

• Gene Symbol: FOXF2   Gene   UCSC   Ensembl
• Aliases: FKHL6, FREAC-2, FREAC2
• Gene name: forkhead box F2
• Alternate names: forkhead box protein F2, forkhead-like 6, forkhead-related activator 2, forkhead-related protein FKHL6, forkhead-related transcription factor 2,
• Gene location: 6p25.3 (1389575: 1395602)     Exons: 2     NC_000006.12
• Gene summary(Entrez): FOXF2 encodes forkhead box F2, one of many human homologues of the Drosophila melanogaster transcription factor forkhead. FOXF2 is expressed in lung and placenta, and has been shown to transcriptionally activate several lung-specific genes. [provided by R

Protein Summary

• Protein general information: Q12947  
  • Name: Forkhead box protein F2 (Forkhead related activator 2) (FREAC 2) (Forkhead related protein FKHL6) (Forkhead related transcription factor 2)
  • Length: 444  
  • Mass: 45993
  • Tissue specificity: Lung and placenta (PubMed
• Sequence:

  MTTEGGPPPAPLRRACSPVPGALQAALMSPPPAAAAAAAAAPETTSSSSSSSSASCASSSSSSNSASAPSAACKS
  AGGGGAGAGSGGAKKASSGLRRPEKPPYSYIALIVMAIQSSPSKRLTLSEIYQFLQARFPFFRGAYQGWKNSVRH
  NLSLNECFIKLPKGLGRPGKGHYWTIDPASEFMFEEGSFRRRPRGFRRKCQALKPMYHRVVSGLGFGASLLPQGF
  DFQAPPSAPLGCHSQGGYGGLDMMPAGYDAGAGAPSHAHPHHHHHHHVPHMSPNPGSTYMASCPVPAGPGGVGAA
  GGGGGGDYGPDSSSSPVPSSPAMASAIECHSPYTSPAAHWSSPGASPYLKQPPALTPSSNPAASAGLHSSMSSYS
  LEQSYLHQNAREDLSVGLPRYQHHSTPVCDRKDFVLNFNGISSFHPSASGSYYHHHHQSVCQDIKPCVM

• Structural information:
  • Interpro: IPR001766  IPR018122  IPR030456  IPR036388  IPR036390  
  • Prosite: PS00657 PS00658 PS50039
  • CDD: cd00059
  • STRING: ENSP00000259806
• Other Databases: GeneCards:  FOXF2  Malacards:  FOXF2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IMP	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	molecular function
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0032434	regulation of proteasomal ubiquitin-dependent protein catabolic process	IDA	biological process
GO:1902914	regulation of protein polyubiquitination	IDA	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0003677	DNA binding	IDA	molecular function
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0042249	establishment of planar polarity of embryonic epithelium	IEA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0030198	extracellular matrix organization	IEA	biological process
GO:0048566	embryonic digestive tract development	IEA	biological process
GO:0048596	embryonic camera-type eye morphogenesis	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0005667	transcription regulator complex	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0043565	sequence-specific DNA binding	IDA	molecular function
GO:0043565	sequence-specific DNA binding	IDA	molecular function
GO:0003700	DNA-binding transcription factor activity	IDA	molecular function
GO:0005634	nucleus	IC	cellular component
GO:0060021	roof of mouth development	IMP	biological process
GO:0008134	transcription factor binding	IPI	molecular function
GO:0048806	genitalia development	IMP	biological process
GO:0008134	transcription factor binding	IPI	molecular function
GO:0001837	epithelial to mesenchymal transition	NAS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881