• Gene id: 22949

Gene Summary

• Gene Symbol: PTGR1   Gene   UCSC   Ensembl
• Aliases: LTB4DH, PGR1, ZADH3
• Gene name: prostaglandin reductase 1
• Alternate names: prostaglandin reductase 1, 15-oxoprostaglandin 13-reductase, NADP-dependent leukotriene B4 12-hydroxydehydrogenase, PRG-1, leukotriene B4 12-hydroxydehydrogenase, zinc binding alcohol dehydrogenase domain containing 3,
• Gene location: 9q31.3 (111599854: 111549721)     Exons: 14     NC_000009.12
• Gene summary(Entrez): This gene encodes an enzyme that is involved in the inactivation of the chemotactic factor, leukotriene B4. The encoded protein specifically catalyzes the NADP+ dependent conversion of leukotriene B4 to 12-oxo-leukotriene B4. A pseudogene of this gene is
• OMIM: 601274

Protein Summary

• Protein general information: Q14914  
  • Name: Prostaglandin reductase 1 (PRG 1) (EC 1.3.1. ) (15 oxoprostaglandin 13 reductase) (EC 1.3.1.48) (NADP dependent leukotriene B4 12 hydroxydehydrogenase) (EC 1.3.1.74)
  • Length: 329  
  • Mass: 35870
  • Tissue specificity: High expression in the kidney, liver, and intestine but not in leukocytes. {ECO
• Sequence:

  MVRTKTWTLKKHFVGYPTNSDFELKTAELPPLKNGEVLLEALFLTVDPYMRVAAKRLKEGDTMMGQQVAKVVESK
  NVALPKGTIVLASPGWTTHSISDGKDLEKLLTEWPDTIPLSLALGTVGMPGLTAYFGLLEICGVKGGETVMVNAA
  AGAVGSVVGQIAKLKGCKVVGAVGSDEKVAYLQKLGFDVVFNYKTVESLEETLKKASPDGYDCYFDNVGGEFSNT
  VIGQMKKFGRIAICGAISTYNRTGPLPPGPPPEIVIYQELRMEAFVVYRWQGDARQKALKDLLKWVLEGKIQYKE
  YIIEGFENMPAAFMGMLKGDNLGKTIVKA

• Structural information:
  • Interpro: IPR013149  IPR041694  IPR011032  IPR036291  IPR020843   IPR014190  
  • CDD: cd08294
  • PDB: 1ZSV 2Y05
  • PDBsum: 1ZSV 2Y05
  • STRING: ENSP00000385763
• Other Databases: GeneCards:  PTGR1  Malacards:  PTGR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006693	prostaglandin metabolic process	IBA	biological process
GO:0047522	15-oxoprostaglandin 13-oxidase activity	IBA	molecular function
GO:0032440	2-alkenal reductase [NAD(P)+] activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0047522	15-oxoprostaglandin 13-oxidase activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0047522	15-oxoprostaglandin 13-oxidase activity	IEA	molecular function
GO:0032440	2-alkenal reductase [NAD(P)+] activity	IEA	molecular function
GO:0036132	13-prostaglandin reductase activity	IEA	molecular function
GO:0097327	response to antineoplastic agent	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0006691	leukotriene metabolic process	NAS	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)