• Gene id: 22948

Gene Summary

• Gene Symbol: CCT5   Gene   UCSC   Ensembl
• Aliases: CCT-epsilon, CCTE, HEL-S-69, PNAS-102, TCP-1-epsilon
• Gene name: chaperonin containing TCP1 subunit 5
• Alternate names: T-complex protein 1 subunit epsilon, chaperonin containing TCP1, subunit 5 (epsilon), epididymis secretory protein Li 69,
• Gene location: 5p15.2 (10249920: 10266411)     Exons: 12     NC_000005.10
• Gene summary(Entrez): The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different p
• OMIM: 610150

Protein Summary

• Protein general information: P48643  
  • Name: T complex protein 1 subunit epsilon (TCP 1 epsilon) (CCT epsilon)
  • Length: 541  
  • Mass: 59671
• Sequence:

  MASMGTLAFDEYGRPFLIIKDQDRKSRLMGLEALKSHIMAAKAVANTMRTSLGPNGLDKMMVDKDGDVTVTNDGA
  TILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEEAEQLLDRGIHPIRIADGYEQAARVAIEHLDK
  ISDSVLVDIKDTEPLIQTAKTTLGSKVVNSCHRQMAEIAVNAVLTVADMERRDVDFELIKVEGKVGGRLEDTKLI
  KGVIVDKDFSHPQMPKKVEDAKIAILTCPFEPPKPKTKHKLDVTSVEDYKALQKYEKEKFEEMIQQIKETGANLA
  ICQWGFDDEANHLLLQNNLPAVRWVGGPEIELIAIATGGRIVPRFSELTAEKLGFAGLVQEISFGTTKDKMLVIE
  QCKNSRAVTIFIRGGNKMIIEEAKRSLHDALCVIRNLIRDNRVVYGGGAAEISCALAVSQEADKCPTLEQYAMRA
  FADALEVIPMALSENSGMNPIQTMTEVRARQVKEMNPALGIDCLHKGTNDMKQQHVIETLIGKKQQISLATQMVR
  MILKIDDIRKPGESEE

• Structural information:
  • Interpro: IPR017998  IPR002194  IPR002423  IPR027409  IPR027413   IPR027410  
  • Prosite: PS00750 PS00751 PS00995
  • PDB: 5UYX 5UYZ 6NR8 6NR9 6NRA 6NRB 6NRC 6NRD 6QB8
  • PDBsum: 5UYX 5UYZ 6NR8 6NR9 6NRA 6NRB 6NRC 6NRD 6QB8
  • DIP: 31181
  • STRING: ENSP00000280326
• Other Databases: GeneCards:  CCT5  Malacards:  CCT5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005832	chaperonin-containing T-complex	IBA	cellular component
GO:0005832	chaperonin-containing T-complex	IDA	cellular component
GO:0006457	protein folding	IEA	biological process
GO:0051082	unfolded protein binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005813	centrosome	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006457	protein folding	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1901998	toxin transport	IEA	biological process
GO:0044297	cell body	IEA	cellular component
GO:0005832	chaperonin-containing T-complex	IEA	cellular component
GO:0007339	binding of sperm to zona pellucida	IEA	biological process
GO:0050821	protein stabilization	IMP	biological process
GO:0032212	positive regulation of telomere maintenance via telomerase	IMP	biological process
GO:1904871	positive regulation of protein localization to Cajal body	HMP	biological process
GO:0005832	chaperonin-containing T-complex	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:1904874	positive regulation of telomerase RNA localization to Cajal body	HMP	biological process
GO:1904851	positive regulation of establishment of protein localization to telomere	IMP	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0003730	mRNA 3'-UTR binding	IDA	molecular function
GO:0048027	mRNA 5'-UTR binding	IDA	molecular function
GO:0005874	microtubule	IDA	cellular component
GO:0031681	G-protein beta-subunit binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0009615	response to virus	IEP	biological process
GO:0048487	beta-tubulin binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Hereditary sensory and autonomic neuropathy	KEGG:H00265
Hereditary sensory and autonomic neuropathy	KEGG:H00265
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray