• Gene id: 22944

Gene Summary

• Gene Symbol: KIN   Gene   UCSC   Ensembl
• Aliases: BTCD, KIN17, Rts2
• Gene name: Kin17 DNA and RNA binding protein
• Alternate names: DNA/RNA-binding protein KIN17, KIN, antigenic determinant of recA protein homolog, binding to curved DNA,
• Gene location: 10p14 (7787992: 7750961)     Exons: 14     NC_000010.11
• Gene summary(Entrez): The protein encoded by this gene is a nuclear protein that forms intranuclear foci during proliferation and is redistributed in the nucleoplasm during the cell cycle. Short-wave ultraviolet light provokes the relocalization of the protein, suggesting its
• OMIM: 601720

Protein Summary

• Protein general information: O60870  
  • Name: DNA/RNA binding protein KIN17 (Binding to curved DNA) (KIN, antigenic determinant of recA protein homolog)
  • Length: 393  
  • Mass: 45374
  • Tissue specificity: Ubiquitously expressed in all tissues examined, with highest levels in skeletal muscle, heart and testis. Differentially expressed in non-tumorigenic and tumorigenic cell lines. Highly expressed in proliferating epithelial keratinocyte
• Sequence:

  MGKSDFLTPKAIANRIKSKGLQKLRWYCQMCQKQCRDENGFKCHCMSESHQRQLLLASENPQQFMDYFSEEFRND
  FLELLRRRFGTKRVHNNIVYNEYISHREHIHMNATQWETLTDFTKWLGREGLCKVDETPKGWYIQYIDRDPETIR
  RQLELEKKKKQDLDDEEKTAKFIEEQVRRGLEGKEQEVPTFTELSRENDEEKVTFNLSKGACSSSGATSSKSSTL
  GPSALKTIGSSASVKRKESSQSSTQSKEKKKKKSALDEIMEIEEEKKRTARTDYWLQPEIIVKIITKKLGEKYHK
  KKAIVKEVIDKYTAVVKMIDSGDKLKLDQTHLETVIPAPGKRILVLNGGYRGNEGTLESINEKTFSATIVIETGP
  LKGRRVEGIQYEDISKLA

• Structural information:
  • Interpro: IPR019447  IPR037321  IPR038254  IPR041330  IPR041995   IPR014722  IPR036236  
  • Prosite: PS00028
  • CDD: cd13155
  • PDB: 2CKK 2V1N
  • PDBsum: 2CKK 2V1N
  • STRING: ENSP00000368881
• Other Databases: GeneCards:  KIN  Malacards:  KIN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006260	DNA replication	IBA	biological process
GO:0003690	double-stranded DNA binding	IBA	molecular function
GO:0006974	cellular response to DNA damage stimulus	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0006281	DNA repair	IEA	biological process
GO:0006260	DNA replication	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006397	mRNA processing	IEA	biological process
GO:0006310	DNA recombination	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0003677	DNA binding	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0003690	double-stranded DNA binding	IEA	molecular function
GO:0006260	DNA replication	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0016363	nuclear matrix	IDA	cellular component
GO:0003723	RNA binding	IDA	molecular function
GO:0006260	DNA replication	IDA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IEP	biological process
GO:0003690	double-stranded DNA binding	ISS	molecular function
GO:0006397	mRNA processing	TAS	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)