• Gene id: 22943

Gene Summary

• Gene Symbol: DKK1   Gene   UCSC   Ensembl
• Aliases: DKK-1, SK
• Gene name: dickkopf WNT signaling pathway inhibitor 1
• Alternate names: dickkopf-related protein 1, dickkopf 1 homolog, dickkopf-1 like, dickkopf-like protein 1,
• Gene location: 10q21.1 (52314280: 52317656)     Exons: 4     NC_000010.11
• Gene summary(Entrez): This gene encodes a member of the dickkopf family of proteins. Members of this family are secreted proteins characterized by two cysteine-rich domains that mediate protein-protein interactions. The encoded protein binds to the LRP6 co-receptor and inhibit
• OMIM: 605189

Protein Summary

• Protein general information: O94907  
  • Name: Dickkopf related protein 1 (Dickkopf 1) (Dkk 1) (hDkk 1) (SK)
  • Length: 266  
  • Mass: 28672
  • Tissue specificity: Placenta.
• Sequence:

  MMALGAAGATRVFVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQ
  TIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEI
  EETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRR
  KGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH

• Structural information:
  • Interpro: IPR006796  IPR039863  
  • PDB: 3S2K 3S8V 3SOQ 5FWW 5GJE
  • PDBsum: 3S2K 3S8V 3SOQ 5FWW 5GJE
  • DIP: 46461
  • STRING: ENSP00000363081
• Other Databases: GeneCards:  DKK1  Malacards:  DKK1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043507	positive regulation of JUN kinase activity	IDA	biological process
GO:0007611	learning or memory	ISS	biological process
GO:1902949	positive regulation of tau-protein kinase activity	ISS	biological process
GO:1901216	positive regulation of neuron death	ISS	biological process
GO:2000096	positive regulation of Wnt signaling pathway, planar cell polarity pathway	TAS	biological process
GO:1904723	negative regulation of Wnt-Frizzled-LRP5/6 complex assembly	TAS	biological process
GO:0010628	positive regulation of gene expression	IGI	biological process
GO:0010628	positive regulation of gene expression	IGI	biological process
GO:0010628	positive regulation of gene expression	ISS	biological process
GO:0010942	positive regulation of cell death	TAS	biological process
GO:0045813	positive regulation of Wnt signaling pathway, calcium modulating pathway	TAS	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	TAS	biological process
GO:0090647	modulation of age-related behavioral decline	ISS	biological process
GO:1904338	regulation of dopaminergic neuron differentiation	TAS	biological process
GO:1904723	negative regulation of Wnt-Frizzled-LRP5/6 complex assembly	IDA	biological process
GO:1904723	negative regulation of Wnt-Frizzled-LRP5/6 complex assembly	IDA	biological process
GO:0032091	negative regulation of protein binding	IDA	biological process
GO:0098883	synapse pruning	TAS	biological process
GO:0039706	co-receptor binding	IPI	molecular function
GO:0039706	co-receptor binding	IPI	molecular function
GO:0039706	co-receptor binding	TAS	molecular function
GO:0039706	co-receptor binding	IPI	molecular function
GO:1904723	negative regulation of Wnt-Frizzled-LRP5/6 complex assembly	IPI	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IDA	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IDA	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IDA	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	TAS	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	NAS	biological process
GO:0039706	co-receptor binding	IBA	molecular function
GO:0090090	negative regulation of canonical Wnt signaling pathway	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0048019	receptor antagonist activity	IBA	molecular function
GO:0043066	negative regulation of apoptotic process	ISS	biological process
GO:0030279	negative regulation of ossification	ISS	biological process
GO:0060173	limb development	ISS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0030178	negative regulation of Wnt signaling pathway	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0008083	growth factor activity	TAS	molecular function
GO:0050750	low-density lipoprotein particle receptor binding	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0090090	negative regulation of canonical Wnt signaling pathway	IGI	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0031901	early endosome membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1905607	negative regulation of presynapse assembly	IEA	biological process
GO:0090647	modulation of age-related behavioral decline	IEA	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0090082	positive regulation of heart induction by negative regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0061743	motor learning	IEA	biological process
GO:0060173	limb development	IEA	biological process
GO:0051966	regulation of synaptic transmission, glutamatergic	IEA	biological process
GO:0050807	regulation of synapse organization	IEA	biological process
GO:0032526	response to retinoic acid	IEA	biological process
GO:0030900	forebrain development	IEA	biological process
GO:0030514	negative regulation of BMP signaling pathway	IEA	biological process
GO:0030178	negative regulation of Wnt signaling pathway	IEA	biological process
GO:0030111	regulation of Wnt signaling pathway	IEA	biological process
GO:0010977	negative regulation of neuron projection development	IEA	biological process
GO:0001707	mesoderm formation	IEA	biological process
GO:0001706	endoderm formation	IEA	biological process
GO:0000904	cell morphogenesis involved in differentiation	IEA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:1904958	positive regulation of midbrain dopaminergic neuron differentiation	IEA	biological process
GO:1902949	positive regulation of tau-protein kinase activity	IEA	biological process
GO:0090244	Wnt signaling pathway involved in somitogenesis	IEA	biological process
GO:0060325	face morphogenesis	IEA	biological process
GO:0060323	head morphogenesis	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0030326	embryonic limb morphogenesis	IEA	biological process
GO:0030279	negative regulation of ossification	IEA	biological process
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0007611	learning or memory	IEA	biological process
GO:0007492	endoderm development	IEA	biological process
GO:0001942	hair follicle development	IEA	biological process
GO:0048019	receptor antagonist activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0033137	negative regulation of peptidyl-serine phosphorylation	IDA	biological process
GO:0060394	negative regulation of pathway-restricted SMAD protein phosphorylation	IDA	biological process
GO:2000726	negative regulation of cardiac muscle cell differentiation	IDA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0002090	regulation of receptor internalization	IDA	biological process
GO:0042662	negative regulation of mesodermal cell fate specification	IDA	biological process
GO:0042663	regulation of endodermal cell fate specification	IDA	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IDA	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IDA	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IDA	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IDA	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IDA	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IDA	biological process
GO:1901296	negative regulation of canonical Wnt signaling pathway involved in cardiac muscle cell fate commitment	IDA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	ISS	biological process
GO:0090082	positive regulation of heart induction by negative regulation of canonical Wnt signaling pathway	ISS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:2000272	negative regulation of signaling receptor activity	IEA	biological process
GO:2000272	negative regulation of signaling receptor activity	IEA	biological process
GO:0030178	negative regulation of Wnt signaling pathway	IDA	biological process
GO:0030178	negative regulation of Wnt signaling pathway	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa05010	Alzheimer disease
hsa04310	Wnt signaling pathway

Diseases

Associated diseases	References
Anodontia	PMID:22984994
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)