• Gene id: 2294

Gene Summary

• Gene Symbol: FOXF1   Gene   UCSC   Ensembl
• Aliases: ACDMPV, FKHL5, FREAC1
• Gene name: forkhead box F1
• Alternate names: forkhead box protein F1, FREAC-1, Forkhead, drosophila, homolog-like 5, forkhead-related activator 1, forkhead-related protein FKHL5, forkhead-related transcription factor 1,
• Gene location: 16q24.1 (86510526: 86515421)     Exons: 2     NC_000016.10
• Gene summary(Entrez): This gene belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the regulation of pulmonary genes as we
• OMIM: 609906

Protein Summary

• Protein general information: Q12946  
  • Name: Forkhead box protein F1 (Forkhead related activator 1) (FREAC 1) (Forkhead related protein FKHL5) (Forkhead related transcription factor 1)
  • Length: 379  
  • Mass: 40122
  • Tissue specificity: Expressed in lung and placenta. {ECO
• Sequence:

  MSSAPEKQQPPHGGGGGGGGGGGAAMDPASSGPSKAKKTNAGIRRPEKPPYSYIALIVMAIQSSPTKRLTLSEIY
  QFLQSRFPFFRGSYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPASEFMFEEGSFRRRPRGFRRKCQA
  LKPMYSMMNGLGFNHLPDTYGFQGSAGGLSCPPNSLALEGGLGMMNGHLPGNVDGMALPSHSVPHLPSNGGHSYM
  GGCGGAAAGEYPHHDSSVPASPLLPTGAGGVMEPHAVYSGSAAAWPPSASAALNSGASYIKQQPLSPCNPAANPL
  SGSLSTHSLEQPYLHQNSHNAPAELQGIPRYHSQSPSMCDRKEFVFSFNAMASSSMHSAGGGSYYHQQVTYQDIK
  PCVM

• Structural information:
  • Interpro: IPR001766  IPR018122  IPR030456  IPR036388  IPR036390  
  • Prosite: PS00657 PS00658 PS50039
  • CDD: cd00059
  • STRING: ENSP00000262426
• Other Databases: GeneCards:  FOXF1  Malacards:  FOXF1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IMP	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IMP	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	molecular function
GO:0048613	embryonic ectodermal digestive tract morphogenesis	IMP	biological process
GO:0003197	endocardial cushion development	IMP	biological process
GO:0007494	midgut development	IMP	biological process
GO:0001763	morphogenesis of a branching structure	IMP	biological process
GO:0097070	ductus arteriosus closure	IMP	biological process
GO:0003214	cardiac left ventricle morphogenesis	IMP	biological process
GO:0001701	in utero embryonic development	IMP	biological process
GO:0060841	venous blood vessel development	IMP	biological process
GO:0001568	blood vessel development	IMP	biological process
GO:0030324	lung development	IMP	biological process
GO:0007507	heart development	IMP	biological process
GO:0060438	trachea development	IMP	biological process
GO:0048557	embryonic digestive tract morphogenesis	IMP	biological process
GO:0072189	ureter development	IMP	biological process
GO:0031016	pancreas development	IMP	biological process
GO:0048565	digestive tract development	IMP	biological process
GO:0060426	lung vasculature development	IMP	biological process
GO:0030323	respiratory tube development	IMP	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0005667	transcription regulator complex	TAS	cellular component
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0001570	vasculogenesis	IEA	biological process
GO:0009887	animal organ morphogenesis	IEA	biological process
GO:0010811	positive regulation of cell-substrate adhesion	IEA	biological process
GO:0014822	detection of wounding	IEA	biological process
GO:0030335	positive regulation of cell migration	IEA	biological process
GO:0060463	lung lobe morphogenesis	IEA	biological process
GO:0061030	epithelial cell differentiation involved in mammary gland alveolus development	IEA	biological process
GO:0090131	mesenchyme migration	IEA	biological process
GO:0098609	cell-cell adhesion	IEA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0001701	in utero embryonic development	IEA	biological process
GO:0001756	somitogenesis	IEA	biological process
GO:0002053	positive regulation of mesenchymal cell proliferation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0007224	smoothened signaling pathway	IEA	biological process
GO:0007368	determination of left/right symmetry	IEA	biological process
GO:0007498	mesoderm development	IEA	biological process
GO:0030198	extracellular matrix organization	IEA	biological process
GO:0030324	lung development	IEA	biological process
GO:0043305	negative regulation of mast cell degranulation	IEA	biological process
GO:0045198	establishment of epithelial cell apical/basal polarity	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0048286	lung alveolus development	IEA	biological process
GO:0048371	lateral mesodermal cell differentiation	IEA	biological process
GO:0048566	embryonic digestive tract development	IEA	biological process
GO:0048617	embryonic foregut morphogenesis	IEA	biological process
GO:0050728	negative regulation of inflammatory response	IEA	biological process
GO:0051145	smooth muscle cell differentiation	IEA	biological process
GO:0060425	lung morphogenesis	IEA	biological process
GO:0060438	trachea development	IEA	biological process
GO:0060441	epithelial tube branching involved in lung morphogenesis	IEA	biological process
GO:0060461	right lung morphogenesis	IEA	biological process
GO:0071345	cellular response to cytokine stimulus	IEA	biological process
GO:0071407	cellular response to organic cyclic compound	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0005634	nucleus	IC	cellular component
GO:0003677	DNA binding	IDA	molecular function
GO:0043565	sequence-specific DNA binding	ISS	molecular function

Diseases

Associated diseases	References
Alveolar capillary dysplasia with misalignment of pulmonary veins	KEGG:H00830
Alveolar capillary dysplasia with misalignment of pulmonary veins	KEGG:H00830
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881