Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 22938
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary
Gene Symbol SNW1   Gene   UCSC   Ensembl
Aliases Bx42, FUN20, NCOA-62, PRPF45, Prp45, SKIIP, SKIP, SKIP1
Gene name SNW domain containing 1
Alternate names SNW domain-containing protein 1, SKI interacting protein, homolog of Drosophila BX42, nuclear protein SkiP, nuclear receptor coactivator NCoA-62, nuclear receptor coactivator, 62-kD, ski-interacting protein,
Gene location 14q24.3 (77761155: 77717598)     Exons: 14     NC_000014.9
Gene summary(Entrez) This gene, a member of the SNW gene family, encodes a coactivator that enhances transcription from some Pol II promoters. This coactivator can bind to the ligand-binding domain of the vitamin D receptor and to retinoid receptors to enhance vitamin D-, ret
OMIM 603055

Protein Summary
Protein general information Q13573  

Name: SNW domain containing protein 1 (Nuclear protein SkiP) (Nuclear receptor coactivator NCoA 62) (Ski interacting protein)

Length: 536  Mass: 61494

Sequence MALTSFLPAPTQLSQDQLEAEEKARSQRSRQTSLVSSRREPPPYGYRKGWIPRLLEDFGDGGAFPEIHVAQYPLD
MGRKKKMSNALAIQVDSEGKIKYDAIARQGQSKDKVIYSKYTDLVPKEVMNADDPDLQRPDEEAIKEITEKTRVA
LEKSVSQKVAAAMPVRAADKLAPAQYIRYTPSQQGVAFNSGAKQRVIRMVEMQKDPMEPPRFKINKKIPRGPPSP
PAPVMHSPSRKMTVKEQQEWKIPPCISNWKNAKGYTIPLDKRLAADGRGLQTVHINENFAKLAEALYIADRKARE
AVEMRAQVERKMAQKEKEKHEEKLREMAQKARERRAGIKTHVEKEDGEARERDEIRHDRRKERQHDRNLSRAAPD
KRSKLQRNENRDISEVIALGVPNPRTSNEVQYDQRLFNQSKGMDSGFAGGEDEIYNVYDQAWRGGKDMAQSIYRP
SKNLDKDMYGDDLEARIKTNRFVPDKEFSGSDRRQRGREGPVQFEEDPFGLDKFLEEAKQHGGSKRPSDSSRPKE
HEHEGKKRRKE
Structural information
Interpro:  IPR017862  IPR004015  

PDB:  		 5MQF 5XJC 5YZG 5Z58 6FF4 6FF7 6ICZ 6ID0 6ID1 6QDV
PDBsum:   5MQF 5XJC 5YZG 5Z58 6FF4 6FF7 6ICZ 6ID0 6ID1 6QDV

DIP:  
34800
MINT:  
STRING:   ENSP00000261531
Other Databases GeneCards:  SNW1  Malacards:  SNW1

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0071013 catalytic step 2 spliceos
ome
 IDA cellular component
GO:0070562 regulation of vitamin D r
eceptor signaling pathway
 IDA biological process
GO:0043923 positive regulation by ho
st of viral transcription
 IDA biological process
GO:0042809 vitamin D receptor bindin
g
 IDA molecular function
GO:0035257 nuclear hormone receptor
binding
 IDA molecular function
GO:0016363 nuclear matrix
 IDA cellular component
GO:0000398 mRNA splicing, via splice
osome
 IC biological process
GO:0071300 cellular response to reti
noic acid
 IDA biological process
GO:0070564 positive regulation of vi
tamin D receptor signalin
g pathway
 IDA biological process
GO:0070564 positive regulation of vi
tamin D receptor signalin
g pathway
 IDA biological process
GO:0048385 regulation of retinoic ac
id receptor signaling pat
hway
 IDA biological process
GO:0048384 retinoic acid receptor si
gnaling pathway
 IDA biological process
GO:0046332 SMAD binding
 IDA molecular function
GO:0045944 positive regulation of tr
anscription by RNA polyme
rase II
 IDA biological process
GO:0045944 positive regulation of tr
anscription by RNA polyme
rase II
 IDA biological process
GO:0042974 retinoic acid receptor bi
nding
 IDA molecular function
GO:0030511 positive regulation of tr
ansforming growth factor
beta receptor signaling p
athway
 IDA biological process
GO:0008024 cyclin/CDK positive trans
cription elongation facto
r complex
 IDA colocalizes with
GO:0003714 transcription corepressor
activity
 IDA molecular function
GO:0003713 transcription coactivator
activity
 IDA molecular function
GO:0003713 transcription coactivator
activity
 IDA molecular function
GO:0000122 negative regulation of tr
anscription by RNA polyme
rase II
 IDA biological process
GO:0000398 mRNA splicing, via splice
osome
 IDA biological process
GO:0071007 U2-type catalytic step 2
spliceosome
 IDA cellular component
GO:0005634 nucleus
 IDA cellular component
GO:0051571 positive regulation of hi
stone H3-K4 methylation
 IMP biological process
GO:0050769 positive regulation of ne
urogenesis
 ISS biological process
GO:0048026 positive regulation of mR
NA splicing, via spliceos
ome
 IMP biological process
GO:0043923 positive regulation by ho
st of viral transcription
 IMP biological process
GO:0042771 intrinsic apoptotic signa
ling pathway in response
to DNA damage by p53 clas
s mediator
 IMP biological process
GO:0005515 protein binding
 IPI molecular function
GO:0000398 mRNA splicing, via splice
osome
 IEA biological process
GO:0005681 spliceosomal complex
 IEA cellular component
GO:0005681 spliceosomal complex
 IEA cellular component
GO:0006397 mRNA processing
 IEA biological process
GO:0008380 RNA splicing
 IEA biological process
GO:0005634 nucleus
 IEA cellular component
GO:0016032 viral process
 IEA biological process
GO:0006357 regulation of transcripti
on by RNA polymerase II
 TAS biological process
GO:0045892 negative regulation of tr
anscription, DNA-template
d
 IDA biological process
GO:0005634 nucleus
 IDA cellular component
GO:0045944 positive regulation of tr
anscription by RNA polyme
rase II
 TAS biological process
GO:0000398 mRNA splicing, via splice
osome
 TAS biological process
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0006367 transcription initiation
from RNA polymerase II pr
omoter
 TAS biological process
GO:0007219 Notch signaling pathway
 TAS biological process
GO:0007221 positive regulation of tr
anscription of Notch rece
ptor target
 TAS biological process
GO:0045747 positive regulation of No
tch signaling pathway
 TAS biological process
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005634 nucleus
 IEA cellular component
GO:0005654 nucleoplasm
 IDA cellular component
GO:0016604 nuclear body
 IDA cellular component
GO:0003713 transcription coactivator
activity
 IDA molecular function
GO:0050681 androgen receptor binding
 IPI molecular function
GO:0016607 nuclear speck
 IDA cellular component
GO:0019899 enzyme binding
 IPI molecular function
GO:0045892 negative regulation of tr
anscription, DNA-template
d
 IDA biological process
GO:0005681 spliceosomal complex
 IDA cellular component
GO:0000398 mRNA splicing, via splice
osome
 IDA biological process
GO:0005634 nucleus
 IDA cellular component
GO:0003723 RNA binding
 HDA molecular function
GO:0005112 Notch binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa05203Viral carcinogenesis
hsa05169Epstein-Barr virus infection
hsa03040Spliceosome
hsa04330Notch signaling pathway

Diseases

Expand All | Collapse All
Associated diseases References
Breast cancer PMID:19377877
pancreatic cancer PMID:20056645
Breast carcinoma PMID:24150787
hepatocellular carcinoma PMID:23696020
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Spermatogenic defects MIK: 31037746
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia
19 (6 controls
, 13 cases)
 Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
 Show abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm
18
 Male infertility GSE26881
 Show abstract
31037746 Spermatoge
nic defect
s
28 men with az
oospermia
 Male infertility Microarray
 Show abstract