• Gene id: 22937

Gene Summary

• Gene Symbol: SCAP   Gene   UCSC   Ensembl
• Gene name: SREBF chaperone
• Alternate names: sterol regulatory element-binding protein cleavage-activating protein, SREBP cleavage-activating protein,
• Gene location: 3p21.31 (69439566: 69395749)     Exons: 10     NC_000002.12
• Gene summary(Entrez): This gene encodes a protein with a sterol sensing domain (SSD) and seven WD domains. In the presence of cholesterol, this protein binds to sterol regulatory element binding proteins (SREBPs) and mediates their transport from the ER to the Golgi. The SREBP
• OMIM: 601510

Protein Summary

• Protein general information: Q12770  
  • Name: Sterol regulatory element binding protein cleavage activating protein (SCAP) (SREBP cleavage activating protein)
  • Length: 1279  
  • Mass: 139729
• Sequence:

  MTLTERLREKISRAFYNHGLLCASYPIPIILFTGFCILACCYPLLKLPLPGTGPVEFTTPVKDYSPPPVDSDRKQ
  GEPTEQPEWYVGAPVAYVQQIFVKSSVFPWHKNLLAVDVFRSPLSRAFQLVEEIRNHVLRDSSGIRSLEELCLQV
  TDLLPGLRKLRNLLPEHGCLLLSPGNFWQNDWERFHADPDIIGTIHQHEPKTLQTSATLKDLLFGVPGKYSGVSL
  YTRKRMVSYTITLVFQHYHAKFLGSLRARLMLLHPSPNCSLRAESLVHVHFKEEIGVAELIPLVTTYIILFAYIY
  FSTRKIDMVKSKWGLALAAVVTVLSSLLMSVGLCTLFGLTPTLNGGEIFPYLVVVIGLENVLVLTKSVVSTPVDL
  EVKLRIAQGLSSESWSIMKNMATELGIILIGYFTLVPAIQEFCLFAVVGLVSDFFLQMLFFTTVLSIDIRRMELA
  DLNKRLPPEACLPSAKPVGQPTRYERQLAVRPSTPHTITLQPSSFRNLRLPKRLRVVYFLARTRLAQRLIMAGTV
  VWIGILVYTDPAGLRNYLAAQVTEQSPLGEGALAPMPVPSGMLPPSHPDPAFSIFPPDAPKLPENQTSPGESPER
  GGPAEVVHDSPVPEVTWGPEDEELWRKLSFRHWPTLFSYYNITLAKRYISLLPVIPVTLRLNPREALEGRHPQDG
  RSAWPPPGPIPAGHWEAGPKGPGGVQAHGDVTLYKVAALGLATGIVLVLLLLCLYRVLCPRNYGQLGGGPGRRRR
  GELPCDDYGYAPPETEIVPLVLRGHLMDIECLASDGMLLVSCCLAGHVCVWDAQTGDCLTRIPRPGRQRRDSGVG
  SGLEAQESWERLSDGGKAGPEEPGDSPPLRHRPRGPPPPSLFGDQPDLTCLIDTNFSAQPRSSQPTQPEPRHRAV
  CGRSRDSPGYDFSCLVQRVYQEEGLAAVCTPALRPPSPGPVLSQAPEDEGGSPEKGSPSLAWAPSAEGSIWSLEL
  QGNLIVVGRSSGRLEVWDAIEGVLCCSSEEVSSGITALVFLDKRIVAARLNGSLDFFSLETHTALSPLQFRGTPG
  RGSSPASPVYSSSDTVACHLTHTVPCAHQKPITALKAAAGRLVTGSQDHTLRVFRLEDSCCLFTLQGHSGAITTV
  YIDQTMVLASGGQDGAICLWDVLTGSRVSHVFAHRGDVTSLTCTTSCVISSGLDDLISIWDRSTGIKFYSIQQDL
  GCGASLGVISDNLLVTGGQGCVSFWDLNYGDLLQTVYLGKNSEAQPARQILVLDNAAIVCNFGSELSLVYVPSVL
  EKLD

• Structural information:
  • Protein Domains: (284..44-)
    (/note="SSD-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00199"-)
  • Interpro: IPR030225  IPR000731  IPR015943  IPR001680  IPR019775   IPR017986  IPR036322  
  • Prosite: PS50156 PS00678 PS50082 PS50294
  • STRING: ENSP00000265565
• Other Databases: GeneCards:  SCAP  Malacards:  SCAP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000139	Golgi membrane	IDA	cellular component
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0032933	SREBP signaling pathway	IEA	biological process
GO:0032934	sterol binding	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0008203	cholesterol metabolic process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0008202	steroid metabolic process	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0032991	protein-containing complex	IEA	cellular component
GO:0007568	aging	IEA	biological process
GO:0045540	regulation of cholesterol biosynthetic process	IEA	biological process
GO:0032868	response to insulin	IEA	biological process
GO:0019217	regulation of fatty acid metabolic process	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0001666	response to hypoxia	IEA	biological process
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0044255	cellular lipid metabolic process	IEA	biological process
GO:0042304	regulation of fatty acid biosynthetic process	IEA	biological process
GO:0008203	cholesterol metabolic process	IEA	biological process
GO:0006955	immune response	IEA	biological process
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0012507	ER to Golgi transport vesicle membrane	IEA	cellular component
GO:0051082	unfolded protein binding	NAS	molecular function
GO:0005783	endoplasmic reticulum	NAS	cellular component
GO:0045716	positive regulation of low-density lipoprotein particle receptor biosynthetic process	NAS	biological process
GO:0016021	integral component of membrane	NAS	cellular component
GO:0032933	SREBP signaling pathway	IMP	biological process
GO:0005794	Golgi apparatus	NAS	cellular component
GO:0045541	negative regulation of cholesterol biosynthetic process	NAS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq