• Gene id: 22933

Gene Summary

• Gene Symbol: SIRT2   Gene   UCSC   Ensembl
• Aliases: SIR2, SIR2L, SIR2L2
• Gene name: sirtuin 2
• Alternate names: NAD-dependent protein deacetylase sirtuin-2, NAD-dependent deacetylase sirtuin-2, SIR2-like protein 2, regulatory protein SIR2 homolog 2, silent information regulator 2, sir2-related protein type 2, sirtuin type 2,
• Gene location: 19q13.2 (38899861: 38878554)     Exons: 17     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been det
• OMIM: 604480

Protein Summary

• Protein general information: Q8IXJ6  
  • Name: NAD dependent protein deacetylase sirtuin 2 (EC 2.3.1.286) (Regulatory protein SIR2 homolog 2) (SIR2 like protein 2)
  • Length: 389  
  • Mass: 43182
  • Tissue specificity: Isoform 1 is expressed in heart, liver and skeletal muscle, weakly expressed in the cortex. Isoform 2 is strongly expressed in the cortex, weakly expressed in heart and liver. Weakly expressed in several malignancies including breast,
• Sequence:

  MAEPDPSHPLETQAGKVQEAQDSDSDSEGGAAGGEADMDFLRNLFSQTLSLGSQKERLLDELTLEGVARYMQSER
  CRRVICLVGAGISTSAGIPDFRSPSTGLYDNLEKYHLPYPEAIFEISYFKKHPEPFFALAKELYPGQFKPTICHY
  FMRLLKDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQ
  SLVKPDIVFFGESLPARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQSDPFLGMI
  MGLGGGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQSGAGVPNPSTSASPKKSPPP
  AKDEARTTEREKPQ

• Structural information:
  • Protein Domains: (65..34-)
    (/note="Deacetylase-sirtuin-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00236"-)
  • Interpro: IPR029035  IPR003000  IPR026591  IPR017328  IPR026590  
  • Prosite: PS50305
  • PDB: 1J8F 3ZGO 3ZGV 4L3O 4R8M 4RMG 4RMH 4RMI 4RMJ 4X3O 4X3P 4Y6L 4Y6O 4Y6Q 5D7O 5D7P 5D7Q 5DY4 5DY5 5FYQ 5G4C 5MAR 5MAT 5Y0Z 5Y5N 5YQL 5YQM 5YQN 5YQO 6NR0 6QCN
  • PDBsum: 1J8F 3ZGO 3ZGV 4L3O 4R8M 4RMG 4RMH 4RMI 4RMJ 4X3O 4X3P 4Y6L 4Y6O 4Y6Q 5D7O 5D7P 5D7Q 5DY4 5DY5 5FYQ 5G4C 5MAR 5MAT 5Y0Z 5Y5N 5YQL 5YQM 5YQN 5YQO 6NR0 6QCN
  • DIP: 33350
  • STRING: ENSP00000249396
• Other Databases: GeneCards:  SIRT2  Malacards:  SIRT2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070403	NAD+ binding	IBA	molecular function
GO:0017136	NAD-dependent histone deacetylase activity	IBA	molecular function
GO:0008134	transcription factor binding	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0090042	tubulin deacetylation	IDA	biological process
GO:0071456	cellular response to hypoxia	IDA	biological process
GO:0071219	cellular response to molecule of bacterial origin	IDA	biological process
GO:0048012	hepatocyte growth factor receptor signaling pathway	IDA	biological process
GO:0046970	NAD-dependent histone deacetylase activity (H4-K16 specific)	IDA	molecular function
GO:0042903	tubulin deacetylase activity	IDA	molecular function
GO:0035729	cellular response to hepatocyte growth factor stimulus	IDA	biological process
GO:0034979	NAD-dependent protein deacetylase activity	IDA	molecular function
GO:0034979	NAD-dependent protein deacetylase activity	IDA	molecular function
GO:0034979	NAD-dependent protein deacetylase activity	IDA	molecular function
GO:0006476	protein deacetylation	IDA	biological process
GO:0006476	protein deacetylation	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0004407	histone deacetylase activity	IDA	molecular function
GO:0003682	chromatin binding	IDA	molecular function
GO:0072686	mitotic spindle	IDA	cellular component
GO:0070933	histone H4 deacetylation	IDA	biological process
GO:0070933	histone H4 deacetylation	IDA	biological process
GO:0034983	peptidyl-lysine deacetylation	IDA	biological process
GO:0033558	protein deacetylase activity	IDA	molecular function
GO:0030496	midbody	IDA	cellular component
GO:0005819	spindle	IDA	cellular component
GO:0005814	centriole	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005694	chromosome	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:2000777	positive regulation of proteasomal ubiquitin-dependent protein catabolic process involved in cellular response to hypoxia	IMP	biological process
GO:1900425	negative regulation of defense response to bacterium	IMP	biological process
GO:1900195	positive regulation of oocyte maturation	ISS	biological process
GO:1900119	positive regulation of execution phase of apoptosis	ISS	biological process
GO:0097386	glial cell projection	ISS	cellular component
GO:0090042	tubulin deacetylation	IMP	biological process
GO:0090042	tubulin deacetylation	ISS	biological process
GO:0071872	cellular response to epinephrine stimulus	ISS	biological process
GO:0070446	negative regulation of oligodendrocyte progenitor proliferation	ISS	biological process
GO:0061433	cellular response to caloric restriction	ISS	biological process
GO:0061428	negative regulation of transcription from RNA polymerase II promoter in response to hypoxia	IMP	biological process
GO:0051987	positive regulation of attachment of spindle microtubules to kinetochore	ISS	biological process
GO:0051781	positive regulation of cell division	ISS	biological process
GO:0051726	regulation of cell cycle	IMP	biological process
GO:0048471	perinuclear region of cytoplasm	ISS	cellular component
GO:0045599	negative regulation of fat cell differentiation	ISS	biological process
GO:0044242	cellular lipid catabolic process	ISS	biological process
GO:0043491	protein kinase B signaling	IMP	biological process
GO:0043388	positive regulation of DNA binding	ISS	biological process
GO:0043219	lateral loop	ISS	cellular component
GO:0043209	myelin sheath	ISS	cellular component
GO:0043209	myelin sheath	ISS	cellular component
GO:0042177	negative regulation of protein catabolic process	IMP	biological process
GO:0034979	NAD-dependent protein deacetylase activity	IMP	molecular function
GO:0034599	cellular response to oxidative stress	ISS	biological process
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	ISS	biological process
GO:0014065	phosphatidylinositol 3-kinase signaling	IMP	biological process
GO:0010801	negative regulation of peptidyl-threonine phosphorylation	ISS	biological process
GO:0008285	negative regulation of cell population proliferation	IMP	biological process
GO:0006476	protein deacetylation	IMP	biological process
GO:0005720	nuclear heterochromatin	ISS	cellular component
GO:2000378	negative regulation of reactive oxygen species metabolic process	ISS	biological process
GO:0072687	meiotic spindle	ISS	cellular component
GO:0070932	histone H3 deacetylation	IMP	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	ISS	biological process
GO:0045836	positive regulation of meiotic nuclear division	ISS	biological process
GO:0044224	juxtaparanode region of axon	ISS	cellular component
GO:0043220	Schmidt-Lanterman incisure	ISS	cellular component
GO:0043220	Schmidt-Lanterman incisure	ISS	cellular component
GO:0043204	perikaryon	ISS	cellular component
GO:0043204	perikaryon	ISS	cellular component
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IMP	biological process
GO:0033558	protein deacetylase activity	IMP	molecular function
GO:0033270	paranode region of axon	ISS	cellular component
GO:0033010	paranodal junction	ISS	cellular component
GO:0033010	paranodal junction	ISS	cellular component
GO:0031641	regulation of myelination	ISS	biological process
GO:0031641	regulation of myelination	ISS	biological process
GO:0022011	myelination in peripheral nervous system	ISS	biological process
GO:0022011	myelination in peripheral nervous system	ISS	biological process
GO:0010507	negative regulation of autophagy	IMP	biological process
GO:0008134	transcription factor binding	IPI	molecular function
GO:0008134	transcription factor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0017136	NAD-dependent histone deacetylase activity	IEA	molecular function
GO:0070403	NAD+ binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0051301	cell division	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0051321	meiotic cell cycle	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0006914	autophagy	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007399	nervous system development	IEA	biological process
GO:0005874	microtubule	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0042903	tubulin deacetylase activity	IDA	molecular function
GO:0090042	tubulin deacetylation	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004407	histone deacetylase activity	IEA	molecular function
GO:0006476	protein deacetylation	IEA	biological process
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0010801	negative regulation of peptidyl-threonine phosphorylation	IEA	biological process
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0034599	cellular response to oxidative stress	IEA	biological process
GO:0042903	tubulin deacetylase activity	IEA	molecular function
GO:0043209	myelin sheath	IEA	cellular component
GO:0043388	positive regulation of DNA binding	IEA	biological process
GO:0044242	cellular lipid catabolic process	IEA	biological process
GO:0045599	negative regulation of fat cell differentiation	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0051781	positive regulation of cell division	IEA	biological process
GO:0051987	positive regulation of attachment of spindle microtubules to kinetochore	IEA	biological process
GO:0061433	cellular response to caloric restriction	IEA	biological process
GO:0071872	cellular response to epinephrine stimulus	IEA	biological process
GO:0090042	tubulin deacetylation	IEA	biological process
GO:1900119	positive regulation of execution phase of apoptosis	IEA	biological process
GO:1900195	positive regulation of oocyte maturation	IEA	biological process
GO:1900425	negative regulation of defense response to bacterium	IEA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0008134	transcription factor binding	IEA	molecular function
GO:0016575	histone deacetylation	IEA	biological process
GO:0022011	myelination in peripheral nervous system	IEA	biological process
GO:0030496	midbody	IEA	cellular component
GO:0031641	regulation of myelination	IEA	biological process
GO:0033010	paranodal junction	IEA	cellular component
GO:0033558	protein deacetylase activity	IEA	molecular function
GO:0043204	perikaryon	IEA	cellular component
GO:0043220	Schmidt-Lanterman incisure	IEA	cellular component
GO:0045598	regulation of fat cell differentiation	IEA	biological process
GO:0045836	positive regulation of meiotic nuclear division	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0070932	histone H3 deacetylation	IEA	biological process
GO:0070933	histone H4 deacetylation	IEA	biological process
GO:0072687	meiotic spindle	IEA	cellular component
GO:1900226	negative regulation of NLRP3 inflammasome complex assembly	IEA	biological process
GO:2000378	negative regulation of reactive oxygen species metabolic process	IEA	biological process
GO:0003950	NAD+ ADP-ribosyltransferase activity	TAS	NOT|molecular function
GO:0006471	protein ADP-ribosylation	TAS	NOT|biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0043209	myelin sheath	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0030426	growth cone	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005814	centriole	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0043204	perikaryon	IEA	cellular component
GO:0030496	midbody	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0006471	protein ADP-ribosylation	IDA	biological process
GO:0003950	NAD+ ADP-ribosyltransferase activity	IDA	molecular function
GO:0000781	chromosome, telomeric region	IEA	cellular component
GO:0021762	substantia nigra development	HEP	biological process
GO:0045843	negative regulation of striated muscle tissue development	IDA	biological process
GO:0043130	ubiquitin binding	IDA	molecular function
GO:0017136	NAD-dependent histone deacetylase activity	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0070403	NAD+ binding	IDA	molecular function
GO:0033558	protein deacetylase activity	IDA	molecular function
GO:0017136	NAD-dependent histone deacetylase activity	IDA	molecular function
GO:0005874	microtubule	IDA	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0042903	tubulin deacetylase activity	IDA	molecular function
GO:0008270	zinc ion binding	IDA	molecular function
GO:0006476	protein deacetylation	IDA	biological process
GO:0016575	histone deacetylation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0000183	rDNA heterochromatin assembly	NAS	biological process
GO:0051775	response to redox state	NAS	biological process
GO:0042826	histone deacetylase binding	IPI	molecular function
GO:0042325	regulation of phosphorylation	NAS	biological process
GO:0008134	transcription factor binding	IPI	molecular function
GO:0008134	transcription factor binding	IPI	molecular function
GO:0006342	chromatin silencing	NAS	biological process
GO:0005677	chromatin silencing complex	NAS	cellular component
GO:0035035	histone acetyltransferase binding	IPI	molecular function
GO:0035035	histone acetyltransferase binding	IPI	molecular function
GO:0007096	regulation of exit from mitosis	NAS	biological process
GO:0006348	chromatin silencing at telomere	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00760	Nicotinate and nicotinamide metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Associated with spermatogenesis and epigenetic regulation	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Associated with spermatogenesis and epigenetic regulation			18	Male infertility	GSE26881
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881