• Gene id: 22932

Gene Summary

• Gene Symbol: POMZP3   Gene   UCSC   Ensembl
• Aliases: POM-ZP3, POM121
• Gene name: POM121 and ZP3 fusion
• Alternate names: POM121 and ZP3 fusion protein, POM (POM121 homolog, rat) and ZP3 fusion, POM (POM121 rat homolog) and ZP3 fusion, POM-ZP3 fusion protein, POM121/ZP3 fusion protein,
• Gene location: 7q11.23 (159904755: 159803354)     Exons: 35     NC_000002.12
• Gene summary(Entrez): This gene appears to have resulted from a fusion of DNA sequences derived from 2 distinct loci, specifically through the duplication of two internal exons from the POM121 gene and four 3' exons from the ZP3 gene. The 5' end of this gene is similar to the
• OMIM: 600587

Protein Summary

• Protein general information: Q6PJE2  
  • Name: POM121 and ZP3 fusion protein (POM ZP3)
  • Length: 187  
  • Mass: 20620
  • Tissue specificity: Expressed in spleen, thymus, pancreas, testis, ovary, small intestine, colon and lymphocytes. {ECO
• Sequence:

  MVCSPVTLRIAPPDRRFSRSAIPEQIISSTLSSPSSNAPDPCAKETVLSALKEKKKKRTVEEEDQIFLDGQENKR
  SCLVDGLTDASSAFKVPRPGPDTLQFTVDVFHFANDSRNMIYITCHLKVTLAEQDPDELNKACSFSKPSNSWFPV
  EGLADICQCCNKGDCGTPSHSRRQPRVVSQWSTSASL

• Structural information:
  • Interpro: IPR040196  IPR001507  
  • STRING: ENSP00000309233
• Other Databases: GeneCards:  POMZP3  Malacards:  POMZP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032190	acrosin binding	IBA	molecular function
GO:0031012	extracellular matrix	IBA	cellular component
GO:2000344	positive regulation of acrosome reaction	IBA	biological process
GO:0035803	egg coat formation	IBA	biological process
GO:0007339	binding of sperm to zona pellucida	IBA	biological process
GO:0007339	binding of sperm to zona pellucida	IEA	biological process
GO:0035803	egg coat formation	IEA	biological process
GO:0035804	structural constituent of egg coat	IEA	molecular function
GO:0005654	nucleoplasm	IDA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0008150	biological_process	ND	biological process
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881