• Gene id: 22928

Gene Summary

• Gene Symbol: SEPHS2   Gene   UCSC   Ensembl
• Aliases: SPS2
• Gene name: selenophosphate synthetase 2
• Alternate names: selenide, water dikinase 2, selenium donor protein 2, selenophosphate synthase 2,
• Gene location: 16p11.2 (30445873: 30443630)     Exons: 1     NC_000016.10
• Gene summary(Entrez): This gene encodes an enzyme that catalyzes the production of monoselenophosphate (MSP) from selenide and ATP. MSP is the selenium donor required for synthesis of selenocysteine (Sec), which is co-translationally incorporated into selenoproteins at in-fram
• OMIM: 606218

Protein Summary

• Protein general information: Q99611  
  • Name: Selenide, water dikinase 2 (EC 2.7.9.3) (Selenium donor protein 2) (Selenophosphate synthase 2)
  • Length: 448  
  • Mass: 47305
• Sequence:

  MAEASATGACGEAMAAAEGSSGPAGLTLGRSFSNYRPFEPQALGLSPSWRLTGFSGMKGUGCKVPQEALLKLLAG
  LTRPDVRPPLGRGLVGGQEEASQEAGLPAGAGPSPTFPALGIGMDSCVIPLRHGGLSLVQTTDFFYPLVEDPYMM
  GRIACANVLSDLYAMGITECDNMLMLLSVSQSMSEEEREKVTPLMVKGFRDAAEEGGTAVTGGQTVVNPWIIIGG
  VATVVCQPNEFIMPDSAVVGDVLVLTKPLGTQVAVNAHQWLDNPERWNKVKMVVSREEVELAYQEAMFNMATLNR
  TAAGLMHTFNAHAATDITGFGILGHSQNLAKQQRNEVSFVIHNLPIIAKMAAVSKASGRFGLLQGTSAETSGGLL
  ICLPREQAARFCSEIKSSKYGEGHQAWIVGIVEKGNRTARIIDKPRVIEVLPRGATAAVLAPDSSNASSEPSS

• Structural information:
  • Interpro: IPR010918  IPR036676  IPR016188  IPR036921  IPR004536  
  • CDD: cd02195
  • STRING: ENSP00000418669
• Other Databases: GeneCards:  SEPHS2  Malacards:  SEPHS2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016260	selenocysteine biosynthetic process	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0004756	selenide, water dikinase activity	IBA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004756	selenide, water dikinase activity	IEA	molecular function
GO:0004756	selenide, water dikinase activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0016259	selenocysteine metabolic process	TAS	biological process
GO:0001887	selenium compound metabolic process	IEA	biological process
GO:0004756	selenide, water dikinase activity	IEA	molecular function
GO:0016260	selenocysteine biosynthetic process	IEA	biological process
GO:0016260	selenocysteine biosynthetic process	NAS	biological process
GO:0005575	cellular_component	ND	cellular component
GO:0004756	selenide, water dikinase activity	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00450	Selenocompound metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray