• Gene id: 22927

Gene Summary

• Gene Symbol: HABP4   Gene   UCSC   Ensembl
• Aliases: IHABP-4, IHABP4, Ki-1/57, SERBP1L
• Gene name: hyaluronan binding protein 4
• Alternate names: intracellular hyaluronan-binding protein 4, chromodomain helicase DNA binding protein 3 interacting protein, intracellular antigen detected by monoclonal antibody Ki-1, ki-1/57 intracellular antigen,
• Gene location: 9q22.32 (96450161: 96491335)     Exons: 9     NC_000009.12
• OMIM: 617369

Protein Summary

• Protein general information: Q5JVS0  
  • Name: Intracellular hyaluronan binding protein 4 (IHABP 4) (IHABP4) (Hyaluronan binding protein 4) (Ki 1/57 intracellular antigen)
  • Length: 413  
  • Mass: 45785
  • Tissue specificity: Highly expressed in brain, heart, and kidney, and moderately expressed in skeletal muscle. Also expressed in a variety of tumor cell lines and in activated but not resting leukocytes. {ECO
• Sequence:

  MKGALGSPVAAAGAAMQESFGCVVANRFHQLLDDESDPFDILREAERRRQQQLQRKRRDEAAAAAGAGPRGGRSP
  AGASGHRAGAGGRRESQKERKSLPAPVAQRPDSPGGGLQAPGQKRTPRRGEQQGWNDSRGPEGMLERAERRSYRE
  YRPYETERQADFTAEKFPDEKPGDRFDRDRPLRGRGGPRGGMRGRGRGGPGNRVFDAFDQRGKREFERYGGNDKI
  AVRTEDNMGGCGVRTWGSGKDTSDVEPTAPMEEPTVVEESQGTPEEESPAKVPELEVEEETQVQEMTLDEWKNLQ
  EQTRPKPEFNIRKPESTVPSKAVVIHKSKYRDDMVKDDYEDDSHVFRKPANDITSQLEINFGNLPRPGRGARGGT
  RGGRGRIRRAENYGPRAEVVMQDVAPNPDDPEDFPALS

• Structural information:
  • Interpro: IPR039764  IPR006861  IPR032381  
  • STRING: ENSP00000364398
• Other Databases: GeneCards:  HABP4  Malacards:  HABP4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0033120	positive regulation of RNA splicing	IBA	biological process
GO:0003723	RNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0045948	positive regulation of translational initiation	IBA	biological process
GO:0005730	nucleolus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0015030	Cajal body	IDA	cellular component
GO:0097504	Gemini of coiled bodies	IDA	cellular component
GO:0010494	cytoplasmic stress granule	IDA	cellular component
GO:0032183	SUMO binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0030578	PML body organization	IDA	biological process
GO:0033120	positive regulation of RNA splicing	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0045948	positive regulation of translational initiation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0006417	regulation of translation	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0006397	mRNA processing	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0008380	RNA splicing	IEA	biological process
GO:0002576	platelet degranulation	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071260	cellular response to mechanical stimulus	IEA	biological process
GO:0030017	sarcomere	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0010494	cytoplasmic stress granule	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0016528	sarcoplasm	IEA	cellular component
GO:0016604	nuclear body	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0015030	Cajal body	IEA	cellular component
GO:0097504	Gemini of coiled bodies	IEA	cellular component
GO:0016607	nuclear speck	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0043392	negative regulation of DNA binding	IDA	biological process
GO:0071260	cellular response to mechanical stimulus	ISS	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0030017	sarcomere	ISS	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R