• Gene id: 22924

Gene Summary

• Gene Symbol: MAPRE3   Gene   UCSC   Ensembl
• Aliases: EB3, EBF3, EBF3-S, RP3
• Gene name: microtubule associated protein RP/EB family member 3
• Alternate names: microtubule-associated protein RP/EB family member 3, APC binding protein, EB1 protein family member 3, end-binding protein 3,
• Gene location: 2p23.3 (26970636: 27027218)     Exons: 9     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the RP/EB family of genes. The protein localizes to the cytoplasmic microtubule network and binds APCL, a homolog of the adenomatous polyposis coli tumor suppressor gene. [provided by RefSeq, Jul 2008]
• OMIM: 605788

Protein Summary

• Protein general information: Q9UPY8  
  • Name: Microtubule associated protein RP/EB family member 3 (EB1 protein family member 3) (EBF3) (End binding protein 3) (EB3) (RP3)
  • Length: 281  
  • Mass: 31982
  • Tissue specificity: Predominantly expressed in brain and muscle. {ECO
• Sequence:

  MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKLEHEYIHNF
  KVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYDGKDYNPLLARQGQDVAPPPNPGDQIFNKSK
  KLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHETDAQILELNQQLVDLKLTVDGLEKERDF
  YFSKLRDIELICQEHESENSPVISGIIGILYATEEGFAPPEDDEIEEHQQEDQDEY

• Structural information:
  • Protein Domains: (14..11-)
    (/note="Calponin-homology-(CH))
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00044-)
    (194..26-)
    (/note="EB1-C-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00576"-)
  • Interpro: IPR001715  IPR036872  IPR004953  IPR036133  IPR027738   IPR042180  IPR027328  
  • Prosite: PS50021 PS51230
  • PDB: 1WYO 3CO1 3JAK 3JAL 3JAR 3TQ7
  • PDBsum: 1WYO 3CO1 3JAK 3JAL 3JAR 3TQ7
  • DIP: 56069
  • STRING: ENSP00000233121
• Other Databases: GeneCards:  MAPRE3  Malacards:  MAPRE3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008022	protein C-terminus binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0045860	positive regulation of protein kinase activity	IDA	biological process
GO:0008104	protein localization	TAS	biological process
GO:0031113	regulation of microtubule polymerization	IMP	biological process
GO:0008017	microtubule binding	IBA	molecular function
GO:0031110	regulation of microtubule polymerization or depolymerization	IBA	biological process
GO:1904825	protein localization to microtubule plus-end	IBA	biological process
GO:0005815	microtubule organizing center	IBA	cellular component
GO:0005874	microtubule	IBA	cellular component
GO:0035371	microtubule plus-end	IBA	cellular component
GO:0035372	protein localization to microtubule	IBA	biological process
GO:0051010	microtubule plus-end binding	IBA	molecular function
GO:0051225	spindle assembly	IBA	biological process
GO:0051233	spindle midzone	IBA	cellular component
GO:0008017	microtubule binding	IEA	molecular function
GO:0051301	cell division	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0005874	microtubule	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0015630	microtubule cytoskeleton	IEA	cellular component
GO:0008017	microtubule binding	IEA	molecular function
GO:1903033	positive regulation of microtubule plus-end binding	IEA	biological process
GO:0045737	positive regulation of cyclin-dependent protein serine/threonine kinase activity	IEA	biological process
GO:0035371	microtubule plus-end	IEA	cellular component
GO:0030496	midbody	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0008017	microtubule binding	ISS	molecular function
GO:0045893	positive regulation of transcription, DNA-templated	ISS	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0030496	midbody	ISS	cellular component
GO:0045737	positive regulation of cyclin-dependent protein serine/threonine kinase activity	ISS	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:1905721	mitotic spindle astral microtubule end	IDA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R