• Gene id: 22921

Gene Summary

• Gene Symbol: MSRB2   Gene   UCSC   Ensembl
• Aliases: CBS-1, CBS1, CGI-131, MSRB, PILB
• Gene name: methionine sulfoxide reductase B2
• Alternate names: methionine-R-sulfoxide reductase B2, mitochondrial, pilin-like transcription factor,
• Gene location: 10p12.2 (23095563: 23122012)     Exons: 6     NC_000010.11
• OMIM: 613782

Protein Summary

• Protein general information: Q9Y3D2  
  • Name: Methionine R sulfoxide reductase B2, mitochondrial (MsrB2) (EC 1.8.4.12) (EC 1.8.4.14)
  • Length: 182  
  • Mass: 19536
  • Tissue specificity: Ubiquitous. Detected in retina, ocular ciliary body, skeletal muscle, heart, colon, bone marrow, cerebellum, small intestine, fetal brain, fetal liver, kidney, spinal cord, lung, placenta and prostate. {ECO
• Sequence:

  MARLLWLLRGLTLGTAPRRAVRGQAGGGGPGTGPGLGEAGSLATCELPLAKSEWQKKLTPEQFYVTREKGTEPPF
  SGIYLNNKEAGMYHCVCCDSPLFSSEKKYCSGTGWPSFSEAHGTSGSDESHTGILRRLDTSLGSARTEVVCKQCE
  AHLGHVFPDGPGPNGQRFCINSVALKFKPRKH

• Structural information:
  • Protein Domains: (51..18-)
    (/note="MsrB-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01126"-)
  • Interpro: IPR028427  IPR002579  IPR011057  
  • Prosite: PS51790
  • STRING: ENSP00000365693
• Other Databases: GeneCards:  MSRB2  Malacards:  MSRB2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008270	zinc ion binding	ISS	molecular function
GO:0033743	peptide-methionine (R)-S-oxide reductase activity	ISS	molecular function
GO:0005739	mitochondrion	ISS	cellular component
GO:0030091	protein repair	ISS	biological process
GO:0033743	peptide-methionine (R)-S-oxide reductase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0030041	actin filament polymerization	ISS	biological process
GO:0003779	actin binding	ISS	molecular function
GO:0033743	peptide-methionine (R)-S-oxide reductase activity	ISS	molecular function
GO:0016671	oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor	IEA	molecular function
GO:0030091	protein repair	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0006979	response to oxidative stress	IEA	biological process
GO:0033743	peptide-methionine (R)-S-oxide reductase activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0033743	peptide-methionine (R)-S-oxide reductase activity	IEA	molecular function
GO:0033745	L-methionine-(R)-S-oxide reductase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0030091	protein repair	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003779	actin binding	IEA	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0030041	actin filament polymerization	IEA	biological process
GO:0030091	protein repair	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0033743	peptide-methionine (R)-S-oxide reductase activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray