• Gene id: 22920

Gene Summary

• Gene Symbol: KIFAP3   Gene   UCSC   Ensembl
• Aliases: FLA3, KAP-1, KAP-3, KAP3, SMAP, Smg-GDS, dJ190I16.1
• Gene name: kinesin associated protein 3
• Alternate names: kinesin-associated protein 3, small G protein GDP dissociation stimulator, smg GDS-associated protein,
• Gene location: 1q24.2 (170085202: 169921325)     Exons: 25     NC_000001.11
• Gene summary(Entrez): The small G protein GDP dissociation stimulator (smg GDS) is a regulator protein having two activities on a group of small G proteins including the Rho and Rap1 family members and Ki-Ras; one is to stimulate their GDP/GTP exchange reactions, and the other
• OMIM: 601836

Protein Summary

• Protein general information: Q92845  
  • Name: Kinesin associated protein 3 (KAP 3) (KAP3) (Smg GDS associated protein)
  • Length: 792  
  • Mass: 91205
• Sequence:

  MQGEDARYLKRKVKGGNIDVHPSEKALIVHYEVEATILGEMGDPMLGERKECQKIIRLKSLNANTDITSLARKVV
  EECKLIHPSKLNEVEQLLYYLQNRRDSLSGKEKKEKSSKPKDPPPFEGMEIDEVANINDMDEYIELLYEDIPDKV
  RGSALILQLARNPDNLEELLLNETALGALARVLREDWKQSVELATNIIYIFFCFSSFSQFHGLITHYKIGALCMN
  IIDHELKRHELWQEELSKKKKAVDEDPENQTLRKDYEKTFKKYQGLVVKQEQLLRVALYLLLNLAEDTRTELKMR
  NKNIVHMLVKALDRDNFELLILVVSFLKKLSIFMENKNDMVEMDIVEKLVKMIPCEHEDLLNITLRLLLNLSFDT
  GLRNKMVQVGLLPKLTALLGNDNYKQIAMCVLYHISMDDRFKSMFAYTDCIPQLMKMLFECSDERIDLELISFCI
  NLAANKRNVQLICEGNGLKMLMKRALKFKDPLLMKMIRNISQHDGPTKNLFIDYVGDLAAQISNDEEEEFVIECL
  GTLANLTIPDLDWELVLKEYKLVPYLKDKLKPGAAEDDLVLEVVIMIGTVSMDDSCAALLAKSGIIPALIELLNA
  QQEDDEFVCQIIYVFYQMVFHQATRDVIIKETQAPAYLIDLMHDKNNEIRKVCDNTLDIIAEYDEEWAKKIQSEK
  FRWHNSQWLEMVESRQMDESEQYLYGDDRIEPYIHEGDILERPDLFYNSDGLIASEGAISPDFFNDYHLQNGDVV
  GQHSFPGSLGMDGFGQPVGILGRPATAYGFRPDEPYYYGYGS

• Structural information:
  • Interpro: IPR011989  IPR016024  IPR000225  IPR008658  
  • Prosite: PS50176
  • STRING: ENSP00000354560
• Other Databases: GeneCards:  KIFAP3  Malacards:  KIFAP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0035869	ciliary transition zone	IBA	cellular component
GO:0016939	kinesin II complex	IBA	cellular component
GO:0007018	microtubule-based movement	IBA	biological process
GO:0005930	axoneme	IBA	cellular component
GO:0044782	cilium organization	IBA	biological process
GO:0005871	kinesin complex	IEA	cellular component
GO:0019894	kinesin binding	IEA	molecular function
GO:0065003	protein-containing complex assembly	TAS	biological process
GO:0005783	endoplasmic reticulum	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0005929	cilium	TAS	cellular component
GO:0005929	cilium	TAS	cellular component
GO:0005929	cilium	TAS	cellular component
GO:0005929	cilium	TAS	cellular component
GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	TAS	biological process
GO:0019886	antigen processing and presentation of exogenous peptide antigen via MHC class II	TAS	biological process
GO:0035735	intraciliary transport involved in cilium assembly	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007018	microtubule-based movement	TAS	biological process
GO:0097542	ciliary tip	TAS	cellular component
GO:0097542	ciliary tip	TAS	cellular component
GO:0097542	ciliary tip	TAS	cellular component
GO:0097542	ciliary tip	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005930	axoneme	IEA	cellular component
GO:0007017	microtubule-based process	IEA	biological process
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0015630	microtubule cytoskeleton	IEA	cellular component
GO:0016939	kinesin II complex	IEA	cellular component
GO:0036064	ciliary basal body	IEA	cellular component
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0046587	positive regulation of calcium-dependent cell-cell adhesion	IEA	biological process
GO:0008104	protein localization	IEA	biological process
GO:0032391	photoreceptor connecting cilium	IEA	cellular component
GO:0120170	intraciliary transport particle B binding	IEA	molecular function
GO:1990075	periciliary membrane compartment	IEA	cellular component
GO:0019894	kinesin binding	IPI	molecular function
GO:0019894	kinesin binding	IPI	molecular function
GO:0000794	condensed nuclear chromosome	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0016939	kinesin II complex	IDA	cellular component
GO:0005876	spindle microtubule	IDA	colocalizes with
GO:0072383	plus-end-directed vesicle transport along microtubule	TAS	biological process
GO:0019903	protein phosphatase binding	IPI	molecular function
GO:0019903	protein phosphatase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016939	kinesin II complex	ISS	cellular component
GO:0007017	microtubule-based process	ISS	biological process

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R