About Us

Search Result


Gene id 22919
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol MAPRE1   Gene   UCSC   Ensembl
Aliases EB1
Gene name microtubule associated protein RP/EB family member 1
Alternate names microtubule-associated protein RP/EB family member 1, APC-binding protein EB1, adenomatous polyposis coli-binding protein EB1, end-binding protein 1,
Gene location 20q11.21 (32819779: 32850404)     Exons: 8     NC_000020.11
Gene summary(Entrez) The protein encoded by this gene was first identified by its binding to the APC protein which is often mutated in familial and sporadic forms of colorectal cancer. This protein localizes to microtubules, especially the growing ends, in interphase cells. D
OMIM 176975

Protein Summary

Protein general information Q15691  

Name: Microtubule associated protein RP/EB family member 1 (APC binding protein EB1) (End binding protein 1) (EB1)

Length: 268  Mass: 29999

Tissue specificity: Ubiquitously expressed. {ECO

Sequence MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHEYIQNF
KILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKDYDPVAARQGQETAVAPSLVAPALNKPK
KPLTSSSAAPQRPISTQRTAAAPKAGPGVVRKNPGVGNGDDEAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIE
LICQENEGENDPVLQRIVDILYATDEGFVIPDEGGPQEEQEEY
Structural information
Protein Domains
(14..11-)
(/note="Calponin-homology-(CH))
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00044-)
(185..25-)
(/note="EB1-C-terminal)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00576"-)
Interpro:  IPR001715  IPR036872  IPR004953  IPR036133  IPR027739  
IPR042180  IPR027328  
Prosite:   PS50021 PS51230

PDB:  
1PA7 1TXQ 1UEG 1VKA 1WU9 1YIB 1YIG 2HKQ 2HL3 2HL5 2QJZ 2R8U 3GJO 3MTU 3MUD 3TQ7 4XA1 4XA3 4XA6 5JV3 5JVM 5JVP 5JVR 5JVS 5JVU 5JX1 5WLQ
PDBsum:   1PA7 1TXQ 1UEG 1VKA 1WU9 1YIB 1YIG 2HKQ 2HL3 2HL5 2QJZ 2R8U 3GJO 3MTU 3MUD 3TQ7 4XA1 4XA3 4XA6 5JV3 5JVM 5JVP 5JVR 5JVS 5JVU 5JX1 5WLQ

DIP:  

38018

MINT:  
STRING:   ENSP00000364721
Other Databases GeneCards:  MAPRE1  Malacards:  MAPRE1

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0005925 focal adhesion
IDA cellular component
GO:0005515 protein binding
IPI molecular function
GO:0019901 protein kinase binding
IPI molecular function
GO:0008104 protein localization
TAS biological process
GO:0016477 cell migration
IMP biological process
GO:0051233 spindle midzone
IBA cellular component
GO:0051225 spindle assembly
IBA biological process
GO:0051010 microtubule plus-end bind
ing
IBA molecular function
GO:0035372 protein localization to m
icrotubule
IBA biological process
GO:0035371 microtubule plus-end
IBA cellular component
GO:0005881 cytoplasmic microtubule
IBA cellular component
GO:0005874 microtubule
IBA cellular component
GO:0005815 microtubule organizing ce
nter
IBA cellular component
GO:1904825 protein localization to m
icrotubule plus-end
IBA biological process
GO:0031110 regulation of microtubule
polymerization or depoly
merization
IBA biological process
GO:0008017 microtubule binding
IBA molecular function
GO:0005813 centrosome
IDA cellular component
GO:0051010 microtubule plus-end bind
ing
IDA molecular function
GO:0035372 protein localization to m
icrotubule
IDA biological process
GO:0031116 positive regulation of mi
crotubule polymerization
IMP biological process
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0008017 microtubule binding
IEA molecular function
GO:0031110 regulation of microtubule
polymerization or depoly
merization
IEA biological process
GO:0005815 microtubule organizing ce
nter
IEA cellular component
GO:0051010 microtubule plus-end bind
ing
IEA molecular function
GO:0005794 Golgi apparatus
IEA cellular component
GO:0051301 cell division
IEA biological process
GO:0005874 microtubule
IEA cellular component
GO:0005856 cytoskeleton
IEA cellular component
GO:0007049 cell cycle
IEA biological process
GO:0005737 cytoplasm
IEA cellular component
GO:0008022 protein C-terminus bindin
g
TAS molecular function
GO:0000086 G2/M transition of mitoti
c cell cycle
TAS biological process
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0010389 regulation of G2/M transi
tion of mitotic cell cycl
e
TAS biological process
GO:0030335 positive regulation of ce
ll migration
TAS biological process
GO:0097711 ciliary basal body-plasma
membrane docking
TAS biological process
GO:0042802 identical protein binding
IPI molecular function
GO:0042802 identical protein binding
IPI molecular function
GO:0042802 identical protein binding
IPI molecular function
GO:0042802 identical protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0042995 cell projection
IEA cellular component
GO:0031253 cell projection membrane
IEA cellular component
GO:0015630 microtubule cytoskeleton
IEA cellular component
GO:0005794 Golgi apparatus
IEA cellular component
GO:0051010 microtubule plus-end bind
ing
IEA molecular function
GO:1903033 positive regulation of mi
crotubule plus-end bindin
g
IEA biological process
GO:0046785 microtubule polymerizatio
n
IEA biological process
GO:0035372 protein localization to m
icrotubule
IEA biological process
GO:0035371 microtubule plus-end
IEA cellular component
GO:0005881 cytoplasmic microtubule
IEA cellular component
GO:0005874 microtubule
IEA cellular component
GO:0001578 microtubule bundle format
ion
IEA biological process
GO:0045296 cadherin binding
HDA molecular function
GO:0005794 Golgi apparatus
IEA cellular component
GO:0005815 microtubule organizing ce
nter
IEA cellular component
GO:0005856 cytoskeleton
IEA cellular component
GO:0031115 negative regulation of mi
crotubule polymerization
IDA biological process
GO:0030981 cortical microtubule cyto
skeleton
IDA cellular component
GO:0051010 microtubule plus-end bind
ing
IDA molecular function
GO:0005874 microtubule
IDA cellular component
GO:0005819 spindle
IDA colocalizes with
GO:0035372 protein localization to m
icrotubule
IDA biological process
GO:1905721 mitotic spindle astral mi
crotubule end
IDA cellular component
GO:0003723 RNA binding
HDA molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005925 focal adhesion
IDA cellular component
GO:0005515 protein binding
IPI molecular function
GO:0019901 protein kinase binding
IPI molecular function
GO:0008104 protein localization
TAS biological process
GO:0016477 cell migration
IMP biological process
GO:0051233 spindle midzone
IBA cellular component
GO:0051225 spindle assembly
IBA biological process
GO:0051010 microtubule plus-end bind
ing
IBA molecular function
GO:0035372 protein localization to m
icrotubule
IBA biological process
GO:0035371 microtubule plus-end
IBA cellular component
GO:0005881 cytoplasmic microtubule
IBA cellular component
GO:0005874 microtubule
IBA cellular component
GO:0005815 microtubule organizing ce
nter
IBA cellular component
GO:1904825 protein localization to m
icrotubule plus-end
IBA biological process
GO:0031110 regulation of microtubule
polymerization or depoly
merization
IBA biological process
GO:0008017 microtubule binding
IBA molecular function
GO:0005813 centrosome
IDA cellular component
GO:0051010 microtubule plus-end bind
ing
IDA molecular function
GO:0035372 protein localization to m
icrotubule
IDA biological process
GO:0031116 positive regulation of mi
crotubule polymerization
IMP biological process
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0008017 microtubule binding
IEA molecular function
GO:0031110 regulation of microtubule
polymerization or depoly
merization
IEA biological process
GO:0005815 microtubule organizing ce
nter
IEA cellular component
GO:0051010 microtubule plus-end bind
ing
IEA molecular function
GO:0005794 Golgi apparatus
IEA cellular component
GO:0051301 cell division
IEA biological process
GO:0005874 microtubule
IEA cellular component
GO:0005856 cytoskeleton
IEA cellular component
GO:0007049 cell cycle
IEA biological process
GO:0005737 cytoplasm
IEA cellular component
GO:0008022 protein C-terminus bindin
g
TAS molecular function
GO:0000086 G2/M transition of mitoti
c cell cycle
TAS biological process
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0010389 regulation of G2/M transi
tion of mitotic cell cycl
e
TAS biological process
GO:0030335 positive regulation of ce
ll migration
TAS biological process
GO:0097711 ciliary basal body-plasma
membrane docking
TAS biological process
GO:0042802 identical protein binding
IPI molecular function
GO:0042802 identical protein binding
IPI molecular function
GO:0042802 identical protein binding
IPI molecular function
GO:0042802 identical protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0042995 cell projection
IEA cellular component
GO:0031253 cell projection membrane
IEA cellular component
GO:0015630 microtubule cytoskeleton
IEA cellular component
GO:0005794 Golgi apparatus
IEA cellular component
GO:0051010 microtubule plus-end bind
ing
IEA molecular function
GO:1903033 positive regulation of mi
crotubule plus-end bindin
g
IEA biological process
GO:0046785 microtubule polymerizatio
n
IEA biological process
GO:0035372 protein localization to m
icrotubule
IEA biological process
GO:0035371 microtubule plus-end
IEA cellular component
GO:0005881 cytoplasmic microtubule
IEA cellular component
GO:0005874 microtubule
IEA cellular component
GO:0001578 microtubule bundle format
ion
IEA biological process
GO:0045296 cadherin binding
HDA molecular function
GO:0005794 Golgi apparatus
IEA cellular component
GO:0005815 microtubule organizing ce
nter
IEA cellular component
GO:0005856 cytoskeleton
IEA cellular component
GO:0031115 negative regulation of mi
crotubule polymerization
IDA biological process
GO:0030981 cortical microtubule cyto
skeleton
IDA cellular component
GO:0051010 microtubule plus-end bind
ing
IDA molecular function
GO:0005874 microtubule
IDA cellular component
GO:0005819 spindle
IDA colocalizes with
GO:0035372 protein localization to m
icrotubule
IDA biological process
GO:1905721 mitotic spindle astral mi
crotubule end
IDA cellular component
GO:0003723 RNA binding
HDA molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm

18
Male infertility GSE26881
Show abstract