• Gene id: 22918

Gene Summary

• Gene Symbol: CD93   Gene   UCSC   Ensembl
• Aliases: C1QR1, C1qR(P), C1qRP, CDw93, ECSM3, MXRA4, dJ737E23.1
• Gene name: CD93 molecule
• Alternate names: complement component C1q receptor, C1q receptor 1, C1q/MBL/SPA receptor, C1qR, CD93 antigen, complement component 1 q subcomponent receptor 1, matrix-remodeling-associated protein 4, matrix-remodelling associated 4,
• Gene location: 20p11.21 (23086829: 23076553)     Exons: 3     NC_000020.11
• Gene summary(Entrez): The protein encoded by this gene is a cell-surface glycoprotein and type I membrane protein that was originally identified as a myeloid cell-specific marker. The encoded protein was once thought to be a receptor for C1q, but now is thought to instead be i
• OMIM: 120577

Protein Summary

• Protein general information: Q9NPY3  
  • Name: Complement component C1q receptor (C1q/MBL/SPA receptor) (C1qR) (C1qR(p)) (C1qRp) (CDw93) (Complement component 1 q subcomponent receptor 1) (Matrix remodeling associated protein 4) (CD antigen CD93)
  • Length: 652  
  • Mass: 68560
  • Tissue specificity: Highly expressed in endothelial cells, platelets, cells of myeloid origin, such as monocytes and neutrophils. Not expressed in cells of lymphoid origin.
• Sequence:

  MATSMGLLLLLLLLLTQPGAGTGADTEAVVCVGTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRV
  LAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQ
  PLLPSRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVAC
  GEGDKDETQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTC
  ASRNPCSSSPCRGGATCVLGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVNTPGGFRCECWVGYEP
  GGPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEEGYVLAGEDGTQCQDVDECVGPGGPLCDSLCFNTQGSF
  HCGCLPGWVLAPNGVSCTMGPVSLGPPSGPPDEEDKGEKEGSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDA
  PITSAPLKMLAPSGSPGVWREPSIHHATAASGPQEPAGGDSSVATQNNDGTDGQKLLLFYILGTVVAILLLLALA
  LGLLVYRKRRAKREEKKEKKPQNAADSYSWVPERAESRAMENQYSPTPGTDC

• Structural information:
  • Protein Domains: (32..17-)
    (/note="C-type-lectin)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00040-)
    (260..30-)
    (/note="EGF-like-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00076-)
    (302..34-)
    (/note="EGF-like-2)
    (/evidence="ECO:0000255|PROSITE-ProRu-)
  • Interpro: IPR001304  IPR016186  IPR026823  IPR016187  IPR001881   IPR013032  IPR000742  IPR000152  IPR018097  IPR009030  
  • Prosite: PS00010 PS50041 PS01186 PS50026 PS01187
  • STRING: ENSP00000246006
• Other Databases: GeneCards:  CD93  Malacards:  CD93

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050431	transforming growth factor beta binding	IBA	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0016032	viral process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030667	secretory granule membrane	TAS	cellular component
GO:0035579	specific granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0070821	tertiary granule membrane	TAS	cellular component
GO:0101003	ficolin-1-rich granule membrane	TAS	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0009986	cell surface	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0001849	complement component C1q complex binding	IDA	molecular function
GO:0098609	cell-cell adhesion	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0006909	phagocytosis	NAS	biological process
GO:0042116	macrophage activation	NAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0006909	phagocytosis	NAS	biological process
GO:0006909	phagocytosis	NAS	biological process
GO:0038023	signaling receptor activity	NAS	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)