• Gene id: 22913

Gene Summary

• Gene Symbol: RALY   Gene   UCSC   Ensembl
• Aliases: HNRPCL2, P542
• Gene name: RALY heterogeneous nuclear ribonucleoprotein
• Alternate names: RNA-binding protein Raly, RNA binding protein, autoantigenic (hnRNP-associated with lethal yellow homolog), RNA-binding protein (autoantigenic), RNA-binding protein (autoantigenic, hnRNP-associated with lethal yellow), autoantigen p542, heterogeneous nuclear r,
• Gene location: 20q11.22 (33993658: 34084883)     Exons: 15     NC_000020.11
• Gene summary(Entrez): This gene encodes a member of the heterogeneous nuclear ribonucleoprotein (hnRNP) gene family. This protein may play a role in pre-mRNA splicing and in embryonic development. Alternate splicing results in multiple transcript variants. [provided by RefSeq,
• OMIM: 612326

Protein Summary

• Protein general information: Q9UKM9  
  • Name: RNA binding protein Raly (Autoantigen p542) (Heterogeneous nuclear ribonucleoprotein C like 2) (hnRNP core protein C like 2) (hnRNP associated with lethal yellow protein homolog)
  • Length: 306  
  • Mass: 32463
  • Tissue specificity: Expressed in heart, brain, lung, liver, skeletal muscle, kidney and pancreas. Weakly expressed in placenta. {ECO
• Sequence:

  MSLKLQASNVTNKNDPKSINSRVFIGNLNTALVKKSDVETIFSKYGRVAGCSVHKGYAFVQYSNERHARAAVLGE
  NGRVLAGQTLDINMAGEPKPDRPKGLKRAASAIYSGYIFDYDYYRDDFYDRLFDYRGRLSPVPVPRAVPVKRPRV
  TVPLVRRVKTNVPVKLFARSTAVTTSSAKIKLKSSELQAIKTELTQIKSNIDALLSRLEQIAAEQKANPDGKKKG
  DGGGAGGGGGGGGSGGGGSGGGGGGGSSRPPAPQENTTSEAGLPQGEARTRDDGDEEGLLTHSEEELEHSQDTDA
  DDGALQ

• Structural information:
  • Protein Domains: (21..9-)
    (/note="RRM-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
  • Interpro: IPR017347  IPR012677  IPR034502  IPR035979  IPR000504  
  • Prosite: PS50102
  • CDD: cd12604
  • PDB: 1WF1
  • PDBsum: 1WF1
  • STRING: ENSP00000246194
• Other Databases: GeneCards:  RALY  Malacards:  RALY

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003723	RNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0071013	catalytic step 2 spliceosome	IDA	cellular component
GO:0000398	mRNA splicing, via spliceosome	IC	biological process
GO:0042632	cholesterol homeostasis	ISS	biological process
GO:0003712	transcription coregulator activity	ISS	molecular function
GO:1903506	regulation of nucleic acid-templated transcription	ISS	biological process
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0005681	spliceosomal complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0008380	RNA splicing	IEA	biological process
GO:0006397	mRNA processing	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0003723	RNA binding	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003712	transcription coregulator activity	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:1903506	regulation of nucleic acid-templated transcription	IEA	biological process
GO:0042632	cholesterol homeostasis	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq