• Gene id: 22906

Gene Summary

• Gene Symbol: TRAK1   Gene   UCSC   Ensembl
• Aliases: EIEE68, MILT1, OIP106
• Gene name: trafficking kinesin protein 1
• Alternate names: trafficking kinesin-binding protein 1, 106 kDa O-GlcNAc transferase-interacting protein, O-linked N-acetylglucosamine transferase interacting protein 106, OGT(O-Glc-NAc transferase)-interacting protein 106 KDa, milton homolog 1, protein Milton, trafficking prot,
• Gene location: 3p22.1 (42013801: 42225889)     Exons: 26     NC_000003.12
• OMIM: 608112

Protein Summary

• Protein general information: Q9UPV9  
  • Name: Trafficking kinesin binding protein 1 (106 kDa O GlcNAc transferase interacting protein) (Protein Milton)
  • Length: 953  
  • Mass: 106040
  • Tissue specificity: High expression in spinal cord and moderate expression in all other tissues and specific brain regions examined. Expressed in all cell lines examined. {ECO
• Sequence:

  MALVFQFGQPVRAQPLPGLCHGKLIRTNACDVCNSTDLPEVEIISLLEEQLPHYKLRADTIYGYDHDDWLHTPLI
  SPDANIDLTTEQIEETLKYFLLCAERVGQMTKTYNDIDAVTRLLEEKERDLELAARIGQSLLKKNKTLTERNELL
  EEQVEHIREEVSQLRHELSMKDELLQFYTSAAEESEPESVCSTPLKRNESSSSVQNYFHLDSLQKKLKDLEEENV
  VLRSEASQLKTETITYEEKEQQLVNDCVKELRDANVQIASISEELAKKTEDAARQQEEITHLLSQIVDLQKKAKA
  CAVENEELVQHLGAAKDAQRQLTAELRELEDKYAECMEMLHEAQEELKNLRNKTMPNTTSRRYHSLGLFPMDSLA
  AEIEGTMRKELQLEEAESPDITHQKRVFETVRNINQVVKQRSLTPSPMNIPGSNQSSAMNSLLSSCVSTPRSSFY
  GSDIGNVVLDNKTNSIILETEAADLGNDERSKKPGTPGTPGSHDLETALRRLSLRRENYLSERRFFEEEQERKLQ
  ELAEKGELRSGSLTPTESIMSLGTHSRFSEFTGFSGMSFSSRSYLPEKLQIVKPLEGSATLHHWQQLAQPHLGGI
  LDPRPGVVTKGFRTLDVDLDEVYCLNDFEEDDTGDHISLPRLATSTPVQHPETSAHHPGKCMSQTNSTFTFTTCR
  ILHPSDELTRVTPSLNSAPTPACGSTSHLKSTPVATPCTPRRLSLAESFTNTRESTTTMSTSLGLVWLLKERGIS
  AAVYDPQSWDRAGRGSLLHSYTPKMAVIPSTPPNSPMQTPTSSPPSFEFKCTSPPYDNFLASKPASSILREVREK
  NVRSSESQTDVSVSNLNLVDKVRRFGVAKVVNSGRAHVPTLTEEQGPLLCGPPGPAPALVPRGLVPEGLPLRCPT
  VTSAIGGLQLNSGIRRNRSFPTMVGSSMQMKAPVTLTSGILMGAKLSKQTSLR

• Structural information:
  • Protein Domains: (47..35-)
    (/note="HAP1-N-terminal")
  • Interpro: IPR006933  IPR022154  
  • STRING: ENSP00000328998
• Other Databases: GeneCards:  TRAK1  Malacards:  TRAK1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005739	mitochondrion	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0098957	anterograde axonal transport of mitochondrion	IBA	biological process
GO:0050811	GABA receptor binding	IBA	molecular function
GO:0047496	vesicle transport along microtubule	IBA	biological process
GO:0031410	cytoplasmic vesicle	IBA	cellular component
GO:0030425	dendrite	IBA	cellular component
GO:0022008	neurogenesis	IBA	biological process
GO:0008333	endosome to lysosome transport	IBA	biological process
GO:0006605	protein targeting	IBA	biological process
GO:0048311	mitochondrion distribution	IBA	biological process
GO:0017022	myosin binding	IBA	molecular function
GO:0008104	protein localization	IBA	biological process
GO:0008089	anterograde axonal transport	IBA	biological process
GO:0005739	mitochondrion	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005102	signaling receptor binding	IBA	molecular function
GO:0005739	mitochondrion	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019896	axonal transport of mitochondrion	IEA	biological process
GO:0098957	anterograde axonal transport of mitochondrion	IEA	biological process
GO:0050811	GABA receptor binding	IEA	molecular function
GO:0050772	positive regulation of axonogenesis	IEA	biological process
GO:0048813	dendrite morphogenesis	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0044295	axonal growth cone	IEA	cellular component
GO:0030911	TPR domain binding	IEA	molecular function
GO:0030425	dendrite	IEA	cellular component
GO:0031966	mitochondrial membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0005938	cell cortex	IEA	cellular component
GO:1904115	axon cytoplasm	IEA	cellular component
GO:1904115	axon cytoplasm	IEA	cellular component
GO:1904115	axon cytoplasm	IEA	cellular component
GO:1904115	axon cytoplasm	IEA	cellular component
GO:0008333	endosome to lysosome transport	IDA	biological process
GO:0005769	early endosome	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0006493	protein O-linked glycosylation	ISS	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0006357	regulation of transcription by RNA polymerase II	ISS	biological process
GO:0006605	protein targeting	ISS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq