• Gene id: 22901

Gene Summary

• Gene Symbol: ARSG   Gene   UCSC   Ensembl
• Aliases: USH4
• Gene name: arylsulfatase G
• Alternate names: arylsulfatase G, ASG,
• Gene location: 17q24.2 (68259169: 68452018)     Exons: 22     NC_000017.11
• Gene summary(Entrez): The protein encoded by this gene belongs to the sulfatase enzyme family. Sulfatases hydrolyze sulfate esters from sulfated steroids, carbohydrates, proteoglycans, and glycolipids. They are involved in hormone biosynthesis, modulation of cell signaling, an

Protein Summary

• Protein general information: Q96EG1  
  • Name: Arylsulfatase G (ASG) (EC 3.1.6.1)
  • Length: 525  
  • Mass: 57061
  • Tissue specificity: Widely expressed, with very low expression in brain, lung, heart and skeletal muscle. {ECO
• Sequence:

  MGWLFLKVLLAGVSFSGFLYPLVDFCISGKTRGQKPNFVIILADDMGWGDLGANWAETKDTANLDKMASEGMRFV
  DFHAAASTCSPSRASLLTGRLGLRNGVTRNFAVTSVGGLPLNETTLAEVLQQAGYVTGIIGKWHLGHHGSYHPNF
  RGFDYYFGIPYSHDMGCTDTPGYNHPPCPACPQGDGPSRNLQRDCYTDVALPLYENLNIVEQPVNLSSLAQKYAE
  KATQFIQRASTSGRPFLLYVALAHMHVPLPVTQLPAAPRGRSLYGAGLWEMDSLVGQIKDKVDHTVKENTFLWFT
  GDNGPWAQKCELAGSVGPFTGFWQTRQGGSPAKQTTWEGGHRVPALAYWPGRVPVNVTSTALLSVLDIFPTVVAL
  AQASLPQGRRFDGVDVSEVLFGRSQPGHRVLFHPNSGAAGEFGALQTVRLERYKAFYITGGARACDGSTGPELQH
  KFPLIFNLEDDTAEAVPLERGGAEYQAVLPEVRKVLADVLQDIANDNISSADYTQDPSVTPCCNPYQIACRCQAA

• Structural information:
  • Interpro: IPR017850  IPR024607  IPR000917  
  • Prosite: PS00523 PS00149
  • STRING: ENSP00000407193
• Other Databases: GeneCards:  ARSG  Malacards:  ARSG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004065	arylsulfatase activity	TAS	molecular function
GO:0004065	arylsulfatase activity	IDA	NOT|molecular function
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0004065	arylsulfatase activity	IBA	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0008484	sulfuric ester hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005764	lysosome	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0006790	sulfur compound metabolic process	IDA	biological process
GO:0004065	arylsulfatase activity	IDA	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005764	lysosome	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04142	Lysosome

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq