• Gene id: 22900

Gene Summary

• Gene Symbol: CARD8   Gene   UCSC   Ensembl
• Aliases: CARDINAL, DACAR, DAKAR, NDPP, NDPP1, TUCAN
• Gene name: caspase recruitment domain family member 8
• Alternate names: caspase recruitment domain-containing protein 8, CARD inhibitor of NF-kappaB-activating ligands, apoptotic protein NDPP1, tumor up-regulated CARD-containing antagonist of CASP9, tumor up-regulated CARD-containing antagonist of caspase nine,
• Gene location: 19q13.33 (48256263: 48203147)     Exons: 21     NC_000019.10
• Gene summary(Entrez): The protein encoded by this gene belongs to the caspase recruitment domain (CARD)-containing family of proteins, which are involved in pathways leading to activation of caspases or nuclear factor kappa-B (NFKB). This protein may be a component of the infl

Protein Summary

• Protein general information: Q9Y2G2  
  • Name: Caspase recruitment domain containing protein 8 (Apoptotic protein NDPP1) (CARD inhibitor of NF kappa B activating ligand) (CARDINAL) (DACAR) (Tumor up regulated CARD containing antagonist of CASP9) (TUCAN)
  • Length: 431  
  • Mass: 48933
  • Tissue specificity: High expression in lung, ovary, testis and placenta. Lower expression in heart, kidney and liver. Also expressed in spleen, lymph node and bone marrow.
• Sequence:

  MMRQRQSHYCSVLFLSVNYLGGTFPGDICSEENQIVSSYASKVCFEIEEDYKNRQFLGPEGNVDVELIDKSTNRY
  SVWFPTAGWYLWSATGLGFLVRDEVTVTIAFGSWSQHLALDLQHHEQWLVGGPLFDVTAEPEEAVAEIHLPHFIS
  LQGEVDVSWFLVAHFKNEGMVLEHPARVEPFYAVLESPSFSLMGILLRIASGTRLSIPITSNTLIYYHPHPEDIK
  FHLYLVPSDALLTKAIDDEEDRFHGVRLQTSPPMEPLNFGSSYIVSNSANLKVMPKELKLSYRSPGEIQHFSKFY
  AGQMKEPIQLEITEKRHGTLVWDTEVKPVDLQLVAASAPPPFSGAAFVKENHRQLQARMGDLKGVLDDLQDNEVL
  TENEKELVEQEKTRQSKNEALLSMVEKKGDLALDVLFRSISERDPYLVSYLRQQNL

• Structural information:
  • Protein Domains: (56..34-)
    (/note="FIIND-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01174-)
    (340..43-)
    (/note="CARD-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00046"-)
  • Interpro: IPR001315  IPR011029  IPR025307  
  • Prosite: PS50209 PS51830
  • PDB: 4IKM
  • PDBsum: 4IKM
  • STRING: ENSP00000375767
• Other Databases: GeneCards:  CARD8  Malacards:  CARD8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0043124	negative regulation of I-kappaB kinase/NF-kappaB signaling	IDA	biological process
GO:0043280	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0008656	cysteine-type endopeptidase activator activity involved in apoptotic process	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032089	NACHT domain binding	IPI	molecular function
GO:0032089	NACHT domain binding	IPI	molecular function
GO:0050718	positive regulation of interleukin-1 beta secretion	IDA	biological process
GO:0008656	cysteine-type endopeptidase activator activity involved in apoptotic process	IBA	molecular function
GO:0050718	positive regulation of interleukin-1 beta secretion	IBA	biological process
GO:0061702	inflammasome complex	IBA	cellular component
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IBA	biological process
GO:0043122	regulation of I-kappaB kinase/NF-kappaB signaling	IBA	biological process
GO:0043280	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process	IBA	biological process
GO:0072559	NLRP3 inflammasome complex	IBA	cellular component
GO:0072559	NLRP3 inflammasome complex	IDA	cellular component
GO:0042981	regulation of apoptotic process	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043280	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0031665	negative regulation of lipopolysaccharide-mediated signaling pathway	IDA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0050713	negative regulation of interleukin-1 beta secretion	IDA	biological process
GO:0097340	inhibition of cysteine-type endopeptidase activity	IDA	biological process
GO:0032088	negative regulation of NF-kappaB transcription factor activity	IMP	biological process
GO:0010804	negative regulation of tumor necrosis factor-mediated signaling pathway	IMP	biological process
GO:0050700	CARD domain binding	IPI	molecular function
GO:0050700	CARD domain binding	IPI	molecular function
GO:0050700	CARD domain binding	IPI	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0043124	negative regulation of I-kappaB kinase/NF-kappaB signaling	IDA	biological process
GO:0043280	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0008656	cysteine-type endopeptidase activator activity involved in apoptotic process	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032089	NACHT domain binding	IPI	molecular function
GO:0032089	NACHT domain binding	IPI	molecular function
GO:0050718	positive regulation of interleukin-1 beta secretion	IDA	biological process
GO:0008656	cysteine-type endopeptidase activator activity involved in apoptotic process	IBA	molecular function
GO:0050718	positive regulation of interleukin-1 beta secretion	IBA	biological process
GO:0061702	inflammasome complex	IBA	cellular component
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IBA	biological process
GO:0043122	regulation of I-kappaB kinase/NF-kappaB signaling	IBA	biological process
GO:0043280	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process	IBA	biological process
GO:0072559	NLRP3 inflammasome complex	IBA	cellular component
GO:0072559	NLRP3 inflammasome complex	IDA	cellular component
GO:0042981	regulation of apoptotic process	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043280	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0031665	negative regulation of lipopolysaccharide-mediated signaling pathway	IDA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0050713	negative regulation of interleukin-1 beta secretion	IDA	biological process
GO:0097340	inhibition of cysteine-type endopeptidase activity	IDA	biological process
GO:0032088	negative regulation of NF-kappaB transcription factor activity	IMP	biological process
GO:0010804	negative regulation of tumor necrosis factor-mediated signaling pathway	IMP	biological process
GO:0050700	CARD domain binding	IPI	molecular function
GO:0050700	CARD domain binding	IPI	molecular function
GO:0050700	CARD domain binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04621	NOD-like receptor signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881