• Gene id: 229

Gene Summary

• Gene Symbol: ALDOB   Gene   UCSC   Ensembl
• Aliases: ALDB, ALDO2
• Gene name: aldolase, fructose-bisphosphate B
• Alternate names: fructose-bisphosphate aldolase B, aldolase 2, aldolase B, fructose-bisphosphatase, aldolase B, fructose-bisphosphate, liver-type aldolase,
• Gene location: 9q31.1 (101435773: 101420559)     Exons: 9     NC_000009.12
• Gene summary(Entrez): Fructose-1,6-bisphosphate aldolase (EC 4.1.2.13) is a tetrameric glycolytic enzyme that catalyzes the reversible conversion of fructose-1,6-bisphosphate to glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. Vertebrates have 3 aldolase isozymes whi
• OMIM: 612724

Protein Summary

• Protein general information: P05062  
  • Name: Fructose bisphosphate aldolase B (EC 4.1.2.13) (Liver type aldolase)
  • Length: 364  
  • Mass: 39473
• Sequence:

  MAHRFPALTQEQKKELSEIAQSIVANGKGILAADESVGTMGNRLQRIKVENTEENRRQFREILFSVDSSINQSIG
  GVILFHETLYQKDSQGKLFRNILKEKGIVVGIKLDQGGAPLAGTNKETTIQGLDGLSERCAQYKKDGVDFGKWRA
  VLRIADQCPSSLAIQENANALARYASICQQNGLVPIVEPEVIPDGDHDLEHCQYVTEKVLAAVYKALNDHHVYLE
  GTLLKPNMVTAGHACTKKYTPEQVAMATVTALHRTVPAAVPGICFLSGGMSEEDATLNLNAINLCPLPKPWKLSF
  SYGRALQASALAAWGGKAANKEATQEAFMKRAMANCQAAKGQYVHTGSSGAASTQSLFTACYTY

• Structural information:
  • Interpro: IPR029768  IPR013785  IPR000741  
  • Prosite: PS00158
  • PDB: 1QO5 1XDL 1XDM
  • PDBsum: 1QO5 1XDL 1XDM
  • STRING: ENSP00000363988
• Other Databases: GeneCards:  ALDOB  Malacards:  ALDOB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061609	fructose-1-phosphate aldolase activity	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0030388	fructose 1,6-bisphosphate metabolic process	IBA	biological process
GO:0006096	glycolytic process	IBA	biological process
GO:0004332	fructose-bisphosphate aldolase activity	IBA	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0004332	fructose-bisphosphate aldolase activity	IEA	molecular function
GO:0006096	glycolytic process	IEA	biological process
GO:0016829	lyase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0006096	glycolytic process	IEA	biological process
GO:0004332	fructose-bisphosphate aldolase activity	IEA	molecular function
GO:0061609	fructose-1-phosphate aldolase activity	IDA	molecular function
GO:0061621	canonical glycolysis	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006094	gluconeogenesis	TAS	biological process
GO:0061624	fructose catabolic process to hydroxyacetone phosphate and glyceraldehyde-3-phosphate	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004332	fructose-bisphosphate aldolase activity	IEA	molecular function
GO:0061609	fructose-1-phosphate aldolase activity	IEA	molecular function
GO:0008092	cytoskeletal protein binding	IDA	molecular function
GO:0004332	fructose-bisphosphate aldolase activity	IDA	molecular function
GO:0004332	fructose-bisphosphate aldolase activity	IDA	molecular function
GO:0004332	fructose-bisphosphate aldolase activity	IDA	molecular function
GO:0051117	ATPase binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0070061	fructose binding	IMP	molecular function
GO:0006116	NADH oxidation	IDA	biological process
GO:0006000	fructose metabolic process	IMP	biological process
GO:0005815	microtubule organizing center	IDA	cellular component
GO:0006096	glycolytic process	IDA	biological process
GO:0030388	fructose 1,6-bisphosphate metabolic process	IDA	biological process
GO:0030388	fructose 1,6-bisphosphate metabolic process	IDA	biological process
GO:0034451	centriolar satellite	IDA	cellular component
GO:0032781	positive regulation of ATPase activity	IGI	biological process
GO:0070072	vacuolar proton-transporting V-type ATPase complex assembly	IGI	biological process
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0006096	glycolytic process	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa01200	Carbon metabolism
hsa04066	HIF-1 signaling pathway
hsa01230	Biosynthesis of amino acids
hsa00010	Glycolysis / Gluconeogenesis
hsa00051	Fructose and mannose metabolism
hsa00030	Pentose phosphate pathway

Diseases

Associated diseases	References
Hereditary fructose intolerance	KEGG:H00071
Hereditary fructose intolerance	KEGG:H00071
type 2 diabetes mellitus	PMID:12646233
Hereditary fructose intolerance syndrome	PMID:15532022
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)