• Gene id: 22891

Gene Summary

• Gene Symbol: ZNF365   Gene   UCSC   Ensembl
• Aliases: Su48, UAN, ZNF365D
• Gene name: zinc finger protein 365
• Alternate names: protein ZNF365, DISC1-binding zinc-finger protein, protein su48, talanin,
• Gene location: 10q21.2 (62374156: 62672010)     Exons: 18     NC_000010.11
• Gene summary(Entrez): This gene encodes a zinc finger protein that may play a role in the repair of DNA damage and maintenance of genome stability. The N-terminal C2H2 zinc finger motif is required to form a protein complex with PARP1 and MRE11, which are known to be involved
• OMIM: 608254

Protein Summary

• Protein general information: Q70YC4  
  • Name: Talanin
  • Length: 216  
  • Mass: 24036
  • Tissue specificity: Isoform 4 is expressed in placenta, lung, kidney and pancreas. {ECO
• Sequence:

  MSALGQITITVSRCWNTERNQTDKNPCLHGAYLQLRETVKNKSTHLKKPLMKQAPPWKDHLTFQPLHPAERKTQV
  WRWQSGNSSDLETTSSASPWPTGSNRDVVLNTLAESCCGLSELITAPPYAGVSIQGFSQIWVLFPFCGGTFHHNE
  KDVLGLQDFERESVSTSQSRNISLLTLGQLQNCVIGKLTIIDLLTEHLLGVRHGVICFPWGLPSSS

• Other Databases: GeneCards:  ZNF365  Malacards:  ZNF365
• Protein general information: Q70YC5  
  
  Name: Protein ZNF365 (DISC1 binding zinc finger protein) (Protein su48)
  
  Length: 407  Mass: 46542
  
  Tissue specificity: Isoform 1 is expressed in brain. Isoform 2 is expressed in placenta and at low level in lung and liver. Isoform 3 is expressed in kidney and pancreas. Isoform 1 is expressed exclusively in brain (PubMed
• Sequence: MQQKAFEESRYPWQESFENVAVCLPLRCPRCGDHTRFRSLSSLRAHLEFSHSYEERTLLTKCSLFPSLKDTDLVT
  SSELLKPGKLQSSGNVVKQKPSYVNLYSISHEHSKDRKPFEVVAERPVSYVQTYTAMDLHADSLDGTRSGPGLPT
  SDTKASFEAHVREKFNRMVEAVDRTIEKRIDKLTKELAQKTAELLEVRAAFVQLTQKKQEVQRRERALNRQVDVA
  VEMIAVLRQRLTESEEELLRKEEEVVTFNHFLEAAAEKEVQGKARLQDFIENLLQRVELAEKQLEYYQSQQASGF
  VRDLSGHVLTDISSNRKPKCLSRGHPHSVCNHPDLKAHFHPKGRNHLKKAKDDRASMQPAKAIHEQAESSRDLCR
  PPKKGELLGFGRKGNIRPKMAKKKPTAIVNII
• Structural information:

  DIP:	35261
  STRING:	ENSP00000387091

• Other Databases: GeneCards:  ZNF365  Malacards:  ZNF365

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005813	centrosome	IDA	cellular component
GO:0010977	negative regulation of neuron projection development	IDA	biological process
GO:0010569	regulation of double-strand break repair via homologous recombination	IMP	biological process
GO:0110026	regulation of DNA strand resection involved in replication fork processing	IMP	biological process
GO:0021687	cerebellar molecular layer morphogenesis	ISS	biological process
GO:0000723	telomere maintenance	IMP	biological process
GO:0140059	dendrite arborization	ISS	biological process
GO:0060997	dendritic spine morphogenesis	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0048714	positive regulation of oligodendrocyte differentiation	ISS	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0007399	nervous system development	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0021687	cerebellar molecular layer morphogenesis	IEA	biological process
GO:0000723	telomere maintenance	IEA	biological process
GO:0048714	positive regulation of oligodendrocyte differentiation	IEA	biological process
GO:0140059	dendrite arborization	IEA	biological process
GO:0060997	dendritic spine morphogenesis	IEA	biological process
GO:0048714	positive regulation of oligodendrocyte differentiation	IEA	biological process
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0034451	centriolar satellite	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq