• Gene id: 2289

Gene Summary

• Gene Symbol: FKBP5   Gene   UCSC   Ensembl
• Aliases: AIG6, FKBP51, FKBP54, P54, PPIase, Ptg-10
• Gene name: FKBP prolyl isomerase 5
• Alternate names: peptidyl-prolyl cis-trans isomerase FKBP5, 51 kDa FK506-binding protein, 51 kDa FKBP, 54 kDa progesterone receptor-associated immunophilin, FF1 antigen, FK506 binding protein 5, FKBP-51, HSP90-binding immunophilin, PPIase FKBP5, T-cell FK506-binding protein, androg,
• Gene location: 6p21.31 (35728582: 35573584)     Exons: 13     NC_000006.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds
• OMIM: 602623

Protein Summary

• Protein general information: Q13451  
  • Name: Peptidyl prolyl cis trans isomerase FKBP5 (PPIase FKBP5) (EC 5.2.1.8) (51 kDa FK506 binding protein) (51 kDa FKBP) (FKBP 51) (54 kDa progesterone receptor associated immunophilin) (Androgen regulated protein 6) (FF1 antigen) (FK506 binding protein 5) (FKB
  • Length: 457  
  • Mass: 51212
  • Tissue specificity: Widely expressed, enriched in testis compared to other tissues.
• Sequence:

  MTTDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNE
  PFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLFEDGGIIR
  RTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGF
  GEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEM
  EYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFE
  KVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQDAKEEANKAMGKKTSEGVTNEKGTDSQAMEE
  EKPEGHV

• Structural information:
  • Protein Domains: (42..13-)
    1 (/note="PPIase-FKBP-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00277-)
    (157..24-)
    2 (/note="PPIase-FKBP-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00277"-)
  • Interpro: IPR031210  IPR023566  IPR001179  IPR013026  IPR011990   IPR001440  IPR019734  
  • Prosite: PS50059 PS50005 PS50293
  • PDB: 1KT0 3O5D 3O5E 3O5F 3O5G 3O5I 3O5J 3O5K 3O5L 3O5M 3O5O 3O5P 3O5Q 3O5R 4DRH 4DRI 4DRK 4DRM 4DRN 4DRO 4DRP 4DRQ 4JFI 4JFJ 4JFK 4JFL 4JFM 4R0X 4TW6 4TW7 4TX0 4W9O 4W9P 4W9Q 5BXJ 5DIT 5DIU 5DIV 5NJX 5OBK 5OMP 6SAF
  • PDBsum: 1KT0 3O5D 3O5E 3O5F 3O5G 3O5I 3O5J 3O5K 3O5L 3O5M 3O5O 3O5P 3O5Q 3O5R 4DRH 4DRI 4DRK 4DRM 4DRN 4DRO 4DRP 4DRQ 4JFI 4JFJ 4JFK 4JFL 4JFM 4R0X 4TW6 4TW7 4TX0 4W9O 4W9P 4W9Q 5BXJ 5DIT 5DIU 5DIV 5NJX 5OBK 5OMP 6SAF
  • DIP: 27597
  • STRING: ENSP00000444810
• Other Databases: GeneCards:  FKBP5  Malacards:  FKBP5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0000413	protein peptidyl-prolyl isomerization	IBA	biological process
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IBA	molecular function
GO:0061077	chaperone-mediated protein folding	IBA	biological process
GO:0061077	chaperone-mediated protein folding	IDA	biological process
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IDA	molecular function
GO:0000413	protein peptidyl-prolyl isomerization	IEA	biological process
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IEA	molecular function
GO:0005528	FK506 binding	IEA	molecular function
GO:0031072	heat shock protein binding	IEA	molecular function
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0016853	isomerase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005528	FK506 binding	TAS	molecular function
GO:0006457	protein folding	TAS	biological process
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0009617	response to bacterium	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0031072	heat shock protein binding	IPI	molecular function
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04915	Estrogen signaling pathway

Diseases

Associated diseases	References
Major depressive disorder	KEGG:H01646
Major depressive disorder	KEGG:H01646
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)