• Gene id: 22888

Gene Summary

• Gene Symbol: UBOX5   Gene   UCSC   Ensembl
• Aliases: RNF37, UBCE7IP5, UIP5, hUIP5
• Gene name: U-box domain containing 5
• Alternate names: RING finger protein 37, RING-type E3 ubiquitin transferase RNF37, U-box domain-containing protein 5, ubcM4-interacting protein 5, ubiquitin conjugating enzyme 7 interacting protein 5,
• Gene location: 20p13 (3159864: 3107572)     Exons: 5     NC_000020.11
• Gene summary(Entrez): This gene encodes a U-box domain containing protein. The encoded protein interacts with E2 enzymes and may play a role in the ubiquitination pathway. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jun 2012]
• OMIM: 607818

Protein Summary

• Protein general information: O94941  
  • Name: RING finger protein 37 (EC 2.3.2.27) (RING type E3 ubiquitin transferase RNF37) (U box domain containing protein 5) (UbcM4 interacting protein 5) (hUIP5) (Ubiquitin conjugating enzyme 7 interacting protein 5)
  • Length: 541  
  • Mass: 58966
  • Tissue specificity: Expressed in liver, heart, brain, kidney and testis. {ECO
• Sequence:

  MVINLCLPQFRPRIHCNKISADGYEVENLISEDLTKRSHGFRTEYFIKPPVYVTVSFPFNVEICRINIDLTAGGG
  QNVTGLEMYTSASSSRVSWNTPQCRTLGPAEPSVPDKEAFTLVGKVLLKNQSQVVFSHRGFKARPPFGAMEATLP
  SPAVVAQELWNKGALSLSHVAHLRICITHVTGGGIPCIKRLEVWGQPAKTCSQEVIDSILLVTSENLPQDVALQA
  PALPMESDCDPGDQPESQQAPSSLQKLAEIIQDVPEEFLDPITLEIMPCPMLLPSGKVIDQSTLEKCNRSEATWG
  RVPSDPFTGVAFTPHSQPLPHPSLKARIDHFLLQHSIPGCHLLGRAQTALAVIPSSIVLPSQKRKIEQAEHVPDS
  NFGVNASCFSATSPLVLPTTSEHTAKKMKATNEPSLTHMDCSTGPLSHEQKLSQSLEIALASTLGSMPSFTARLT
  RGQLQHLGTRGSNTSWRPGTGSEQPGSILGPECASCKRVFSPYFKKEPVYQLPCGHLLCRPCLGEKQRSLPMTCT
  ACQRPVASQDVLRVHF

• Structural information:
  • Protein Domains: (258..33-)
    (/note="U-box"-)
  • Interpro: IPR039925  IPR039847  IPR003613  IPR001841  IPR013083   IPR017907  
  • Prosite: PS51698 PS00518 PS50089
  • CDD: cd16660
  • STRING: ENSP00000217173
• Other Databases: GeneCards:  UBOX5  Malacards:  UBOX5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031625	ubiquitin protein ligase binding	IBA	molecular function
GO:0034450	ubiquitin-ubiquitin ligase activity	IBA	molecular function
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0000209	protein polyubiquitination	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0034450	ubiquitin-ubiquitin ligase activity	ISS	molecular function
GO:0005634	nucleus	ISS	cellular component
GO:0000209	protein polyubiquitination	ISS	biological process
GO:0004842	ubiquitin-protein transferase activity	IEA	molecular function
GO:0016567	protein ubiquitination	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0061630	ubiquitin protein ligase activity	IEA	molecular function
GO:0034450	ubiquitin-ubiquitin ligase activity	IEA	molecular function
GO:0031625	ubiquitin protein ligase binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0000209	protein polyubiquitination	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04120	Ubiquitin mediated proteolysis

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq