• Gene id: 22880

Gene Summary

• Gene Symbol: MORC2   Gene   UCSC   Ensembl
• Aliases: CMT2Z, ZCW3, ZCWCC1
• Gene name: MORC family CW-type zinc finger 2
• Alternate names: ATPase MORC2, zinc finger CW-type coiled-coil domain protein 1,
• Gene location: 22q12.2 (30968773: 30925129)     Exons: 27     NC_000022.11
• Gene summary(Entrez): This gene encodes a member of the Microrchidia (MORC) protein superfamily. The encoded protein is known to regulate the condensation of heterochromatin in response to DNA damage and play a role in repressing transcription. The protein has been found to re

Protein Summary

• Protein general information: Q9Y6X9  
  • Name: ATPase MORC2 (EC 3.6.1.3) (MORC family CW type zinc finger protein 2) (Zinc finger CW type coiled coil domain protein 1)
  • Length: 1032  
  • Mass: 117823
  • Tissue specificity: Highly expressed in smooth muscle, pancreas and testis.
• Sequence:

  MAFTNYSSLNRAQLTFEYLHTNSTTHEFLFGALAELVDNARDADATRIDIYAERREDLRGGFMLCFLDDGAGMDP
  SDAASVIQFGKSAKRTPESTQIGQYGNGLKSGSMRIGKDFILFTKKEDTMTCLFLSRTFHEEEGIDEVIVPLPTW
  NARTREPVTDNVEKFAIETELIYKYSPFRTEEEVMTQFMKIPGDSGTLVIIFNLKLMDNGEPELDIISNPRDIQM
  AETSPEGTKPERRSFRAYAAVLYIDPRMRIFIHGHKVQTKRLSCCLYKPRMYKYTSSRFKTRAEQEVKKAEHVAR
  IAEEKAREAESKARTLEVRLGGDLTRDSRVMLRQVQNRAITLRREADVKKRIKEAKQRALKEPKELNFVFGVNIE
  HRDLDGMFIYNCSRLIKMYEKVGPQLEGGMACGGVVGVVDVPYLVLEPTHNKQDFADAKEYRHLLRAMGEHLAQY
  WKDIAIAQRGIIKFWDEFGYLSANWNQPPSSELRYKRRRAMEIPTTIQCDLCLKWRTLPFQLSSVEKDYPDTWVC
  SMNPDPEQDRCEASEQKQKVPLGTFRKDMKTQEEKQKQLTEKIRQQQEKLEALQKTTPIRSQADLKKLPLEVTTR
  PSTEEPVRRPQRPRSPPLPAVIRNAPSRPPSLPTPRPASQPRKAPVISSTPKLPALAAREEASTSRLLQPPEAPR
  KPANTLVKTASRPAPLVQQLSPSLLPNSKSPREVPSPKVIKTPVVKKTESPIKLSPATPSRKRSVAVSDEEEVEE
  EAERRKERCKRGRFVVKEEKKDSNELSDSAGEEDSADLKRAQKDKGLHVEVRVNREWYTGRVTAVEVGKHVVRWK
  VKFDYVPTDTTPRDRWVEKGSEDVRLMKPPSPEHQSLDTQQEGGEEEVGPVAQQAIAVAEPSTSECLRIEPDTTA
  LSTNHETIDLLVQILRNCLRYFLPPSFPISKKQLSAMNSDELISFPLKEYFKQYEVGLQNLCNSYQSRADSRAKA
  SEESLRTSERKLRETEEKLQKLRTNIVALLQKVQEDIDINTDDELDAYIEDLITKGD

• Structural information:
  • Interpro: IPR036890  IPR041006  IPR011124  
  • Prosite: PS51050
  • PDB: 5OF9 5OFA 5OFB
  • PDBsum: 5OF9 5OFA 5OFB
  • STRING: ENSP00000215862
• Other Databases: GeneCards:  MORC2  Malacards:  MORC2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0003682	chromatin binding	IDA	molecular function
GO:0003682	chromatin binding	IDA	molecular function
GO:0016363	nuclear matrix	IDA	cellular component
GO:0000287	magnesium ion binding	IDA	molecular function
GO:0008270	zinc ion binding	IDA	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0000792	heterochromatin	IDA	cellular component
GO:0045814	negative regulation of gene expression, epigenetic	IDA	biological process
GO:0090309	positive regulation of DNA methylation-dependent heterochromatin assembly	IDA	biological process
GO:0090309	positive regulation of DNA methylation-dependent heterochromatin assembly	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0016887	ATPase activity	IDA	molecular function
GO:0006338	chromatin remodeling	IDA	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005524	ATP binding	IDA	molecular function
GO:0016887	ATPase activity	IDA	molecular function
GO:0045814	negative regulation of gene expression, epigenetic	IDA	biological process
GO:0045869	negative regulation of single stranded viral RNA replication via double stranded DNA intermediate	IMP	biological process
GO:0045869	negative regulation of single stranded viral RNA replication via double stranded DNA intermediate	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0016887	ATPase activity	IEA	molecular function
GO:0005694	chromosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0016363	nuclear matrix	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Charcot-Marie-Tooth disease	KEGG:H00264
Charcot-Marie-Tooth disease	KEGG:H00264
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray