• Gene id: 22873

Gene Summary

• Gene Symbol: DZIP1   Gene   UCSC   Ensembl
• Aliases: DZIP, DZIPt1
• Gene name: DAZ interacting zinc finger protein 1
• Alternate names: zinc finger protein DZIP1, DAZ interacting protein 1, DAZ interacting protein testis1, DAZ-interacting protein 1/2, zinc finger DAZ interacting protein 1, zinc-finger protein DZIPt1,
• Gene location: 13q32.1 (95644705: 95578201)     Exons: 24     NC_000013.11
• OMIM: 608671

Protein Summary

• Protein general information: Q86YF9  
  • Name: Zinc finger protein DZIP1 (DAZ interacting protein 1/2)
  • Length: 867  
  • Mass: 98664
  • Tissue specificity: Predominantly expressed in testis. Also expressed in fetal brain, adult oocytes and ovary. Expressed in undifferentiated ES cells. In testis, it is probably specifically expressed in germ cells. Expressed in mature germ cells and secon
• Sequence:

  MQAEAADWFSSMPFQKHVYYPLASGPEGPDVAVAAAAAGAASMACAPPSAASGPLPFFQFRPRLESVDWRRLSAI
  DVDKVAGAVDVLTLQENIMNITFCKLEDEKCPHCQSGVDPVLLKLIRLAQFTIEYLLHSQEFLTSQLHTLEERLR
  LSHCDGEQSKKLLTKQAGEIKTLKEECKRRKKMISTQQLMIEAKANYYQCHFCDKAFMNQAFLQSHIQRRHTEEN
  SHFEYQKNAQIEKLRSEIVVLKEELQLTRSELEAAHHASAVRFSKEYEMQKTKEEDFLKLFDRWKEEEKEKLVDE
  MEKVKEMFMKEFKELTSKNSALEYQLSEIQKSNMQIKSNIGTLKDAHEFKEDRSPYPQDFHNVMQLLDSQESKWT
  ARVQAIHQEHKKEKGRLLSHIEKLRTSMIDDLNASNVFYKKRIEELGQRLQEQNELIITQRQQIKDFTCNPLNSI
  SEPKGNPLAWQAFESQPAAPAVPMNAPALHTLETKSSLPMVHEQAFSSHILEPIEELSEEEKGRENEQKLNNNKM
  HLRKALKSNSSLTKGLRTMVEQNLMEKLETLGINADIRGISSDQLHRVLKSVESERHKQEREIPNFHQIREFLEH
  QVSCKIEEKALLSSDQCSVSQMDTLSTGEVPKMIQLPSKNRQLIRQKAVSTDRTSVPKIKKNVMEDPFPRKSSTI
  TTPPFSSEEEQEDDDLIRAYASPGPLPVPPPQNKGSFGKNTVKSDADGTEGSEIEDTDDSPKPAGVAVKTPTEKV
  EKMFPHRKNVNKPVGGTNVPEMFIKKEELQELKCADVEDEDWDISSLEEEISLGKKSGKEQKEPPPAKNEPHFAH
  VLNAWGAFNPKGPKGEGLQENESSTLKSSLVTVTDWSDTSDV

• Structural information:
  • Interpro: IPR032714  IPR013087  
  • Prosite: PS00028 PS50157
  • DIP: 35710
  • STRING: ENSP00000257312
• Other Databases: GeneCards:  DZIP1  Malacards:  DZIP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0036064	ciliary basal body	IBA	cellular component
GO:0060271	cilium assembly	IBA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005814	centriole	IEA	cellular component
GO:0007224	smoothened signaling pathway	IEA	biological process
GO:0033365	protein localization to organelle	IEA	biological process
GO:0043393	regulation of protein binding	IEA	biological process
GO:0044782	cilium organization	IEA	biological process
GO:0045184	establishment of protein localization	IEA	biological process
GO:0061512	protein localization to cilium	IEA	biological process
GO:0036064	ciliary basal body	IEA	cellular component
GO:0045724	positive regulation of cilium assembly	IEA	biological process
GO:0051220	cytoplasmic sequestering of protein	IEA	biological process
GO:0060271	cilium assembly	IEA	biological process
GO:0097539	ciliary transition fiber	IEA	cellular component
GO:0036064	ciliary basal body	IDA	cellular component
GO:0005814	centriole	IDA	colocalizes with
GO:0060271	cilium assembly	IMP	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005814	centriole	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0034451	centriolar satellite	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0007281	germ cell development	IEP	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Multiple Morphological Abnormalities of the sperm Flagella	MIK: 32051257
Asthenoteratozoospermia with severe MMAF	MIK: 32051257
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
32051257	Asthenoteratospermia with severe MMAF	c.188G>A (p.Arg63Gln), c.690T>G (p.Tyr230*)		877 (875 controls, 2 cases)	Male infertility
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray