• Gene id: 2287

Gene Summary

• Gene Symbol: FKBP3   Gene   UCSC   Ensembl
• Aliases: FKBP-25, FKBP-3, FKBP25, PPIase
• Gene name: FKBP prolyl isomerase 3
• Alternate names: peptidyl-prolyl cis-trans isomerase FKBP3, 25 kDa FK506-binding protein, 25 kDa FKBP, FK506 binding protein 3, 25kDa, FK506-binding protein 25, T-cell, FK506-binding protein 3, PPIase FKBP3, immunophilin FKBP25, rapamycin binding protein, rapamycin-selective 25 kD,
• Gene location: 14q21.2 (45134480: 45115291)     Exons: 7     NC_000014.9
• Gene summary(Entrez): The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds
• OMIM: 186947

Protein Summary

• Protein general information: Q00688  
  • Name: Peptidyl prolyl cis trans isomerase FKBP3 (PPIase FKBP3) (EC 5.2.1.8) (25 kDa FK506 binding protein) (25 kDa FKBP) (FKBP 25) (FK506 binding protein 3) (FKBP 3) (Immunophilin FKBP25) (Rapamycin selective 25 kDa immunophilin) (Rotamase)
  • Length: 224  
  • Mass: 25177
• Sequence:

  MAAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETKRFKGT
  ESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQ
  TSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID

• Structural information:
  • Protein Domains: (128..22-)
    (/note="PPIase-FKBP-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00277"-)
  • Interpro: IPR041200  IPR001179  
  • Prosite: PS50059
  • PDB: 1PBK 2KFV 2MPH 5D75 5GPG
  • PDBsum: 1PBK 2KFV 2MPH 5D75 5GPG
  • STRING: ENSP00000216330
• Other Databases: GeneCards:  FKBP3  Malacards:  FKBP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IEA	molecular function
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0016853	isomerase activity	IEA	molecular function
GO:0005528	FK506 binding	TAS	molecular function
GO:0038023	signaling receptor activity	TAS	molecular function
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0000413	protein peptidyl-prolyl isomerization	IEA	biological process
GO:0000413	protein peptidyl-prolyl isomerization	IEA	biological process
GO:0000413	protein peptidyl-prolyl isomerization	IEA	biological process
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881